Endometriosis Knowledgebase

Search Result

Gene id

3690

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ITGB3 Gene UCSC Ensembl

Aliases

BDPLT16, BDPLT2, CD61, GP3A, GPIIIa, GT

Gene name

integrin subunit beta 3

Alternate names

integrin beta-3, antigen CD61, integrin beta 3, integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), platelet membrane glycoprotein IIIa,

Gene location

17q21.32 (47253841: 47312710) Exons: 15 NC_000017.11

Gene summary(Entrez)

The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. [provided by RefSeq, Jul 2008]

OMIM

173470

Protein Summary

Protein general information

P05106

Name: Integrin beta 3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)

Length: 788 Mass: 87,058

Tissue specificity: Isoform beta-3A and isoform beta-3C are widely expressed. Isoform beta-3A is specifically expressed in osteoblast cells; isoform beta-3C is specifically expressed in prostate and testis.

Sequence

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNC
APESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSM
KDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQ
VTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYG
KIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDS
LIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRG
ECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTG
KDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDR
KEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT

Structural information

Protein Domains	VWFA. (135-377)
Interpro:	IPR013111 IPR027068 IPR033760 IPR015812 IPR014836 IPR012896 IPR002369 IPR032695 IPR016201 IPR002035
Prosite:	PS00022 PS01186 PS00243
Pfam:	PF07974 PF08725 PF07965 PF00362 PF17205
PDB:	1JV2 1KUP 1KUZ 1L5G 1M1X 1M8O 1MIZ 1MK7 1MK9 1RN0 1S4X 1TYE 1U8C 2INI 2K9J 2KNC 2KV9 2L1C 2L91 2LJD 2LJE 2LJF 2MTP 2N9Y 2Q6W 2RMZ 2RN0 2VC2 2VDK 2VDL 2VDM 2VDN 2VDO 2VDP 2VDQ 2VDR 3FCS 3FCU 3IJE 3NID 3NIF 3NIG 3T3M 3T3P 3ZDX 3ZDY 3ZDZ 3ZE0 3ZE1 3ZE2 4CAK
PDBsum:	1JV2 1KUP 1KUZ 1L5G 1M1X 1M8O 1MIZ 1MK7 1MK9 1RN0 1S4X 1TYE 1U8C 2INI 2K9J 2KNC 2KV9 2L1C 2L91 2LJD 2LJE 2LJF 2MTP 2N9Y 2Q6W 2RMZ 2RN0 2VC2 2VDK 2VDL 2VDM 2VDN 2VDO 2VDP 2VDQ 2VDR 3FCS 3FCU 3IJE 3NID 3NIF 3NIG 3T3M 3T3P 3ZDX 3ZDY 3ZDZ 3ZE0 3ZE1 3ZE2 4CAK
DIP:	304
MINT:	209501
STRING:	ENSP00000262017;

Other Databases

GeneCards: ITGB3; Malacards: ITGB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	TAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001968	fibronectin binding	IMP	molecular_function
GO:0002020	protease binding	IDA	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0003756	protein disulfide isomera se activity	IDA	molecular_function
GO:0003756	protein disulfide isomera se activity	IDA	molecular_function
GO:0005161	platelet-derived growth f actor receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007044	cell-substrate junction a ssembly	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008305	integrin complex	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010888	negative regulation of li pid storage	IMP	biological_process
GO:0014909	smooth muscle cell migrat ion	IMP	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016049	cell growth	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030168	platelet activation	IMP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	TAS	biological_process
GO:0031092	platelet alpha granule me mbrane	TAS	cellular_component
GO:0031258	lamellipodium membrane	IDA	cellular_component
GO:0031527	filopodium membrane	IDA	cellular_component
GO:0031528	microvillus membrane	IDA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0032147	activation of protein kin ase activity	IMP	biological_process
GO:0032369	negative regulation of li pid transport	IMP	biological_process
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0035295	tube development	TAS	biological_process
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0042060	wound healing	IC	biological_process
GO:0042470	melanosome	IDA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043184	vascular endothelial grow th factor receptor 2 bind ing	IPI	molecular_function
GO:0043184	vascular endothelial grow th factor receptor 2 bind ing	TAS	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0045124	regulation of bone resorp tion	TAS	biological_process
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IMP	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048333	mesodermal cell different iation	IEP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IMP	biological_process
GO:0050748	negative regulation of li poprotein metabolic proce ss	IMP	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050840	extracellular matrix bind ing	IDA	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0060055	angiogenesis involved in wound healing	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070527	platelet aggregation	IMP	biological_process
GO:0071062	alphav-beta3 integrin-vit ronectin complex	TAS	cellular_component
GO:0017134	fibroblast growth factor binding	IDA	molecular_function
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	TAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001968	fibronectin binding	IMP	molecular_function
GO:0002020	protease binding	IDA	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0003756	protein disulfide isomera se activity	IDA	molecular_function
GO:0003756	protein disulfide isomera se activity	IDA	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0005161	platelet-derived growth f actor receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007044	cell-substrate junction a ssembly	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0008305	integrin complex	TAS	cellular_component
GO:0008305	integrin complex	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010888	negative regulation of li pid storage	IMP	biological_process
GO:0014909	smooth muscle cell migrat ion	IMP	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016049	cell growth	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030054	cell junction	IEA	cellular_component
GO:0030168	platelet activation	IMP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	TAS	biological_process
GO:0031092	platelet alpha granule me mbrane	TAS	cellular_component
GO:0031258	lamellipodium membrane	IEA	cellular_component
GO:0031258	lamellipodium membrane	IDA	cellular_component
GO:0031527	filopodium membrane	IDA	cellular_component
GO:0031528	microvillus membrane	IDA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0032147	activation of protein kin ase activity	IMP	biological_process
GO:0032369	negative regulation of li pid transport	IMP	biological_process
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0035295	tube development	TAS	biological_process
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0042060	wound healing	IC	biological_process
GO:0042470	melanosome	IDA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042995	cell projection	IEA	cellular_component
GO:0043184	vascular endothelial grow th factor receptor 2 bind ing	IPI	molecular_function
GO:0043184	vascular endothelial grow th factor receptor 2 bind ing	TAS	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0045124	regulation of bone resorp tion	TAS	biological_process
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IMP	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048333	mesodermal cell different iation	IEP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IMP	biological_process
GO:0050748	negative regulation of li poprotein metabolic proce ss	IMP	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050840	extracellular matrix bind ing	IDA	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0060055	angiogenesis involved in wound healing	IEA	biological_process
GO:0060055	angiogenesis involved in wound healing	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070527	platelet aggregation	IEA	biological_process
GO:0070527	platelet aggregation	IMP	biological_process
GO:0071062	alphav-beta3 integrin-vit ronectin complex	TAS	cellular_component
GO:0017134	fibroblast growth factor binding	IDA	molecular_function
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	TAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001968	fibronectin binding	IMP	molecular_function
GO:0002020	protease binding	IDA	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0003756	protein disulfide isomera se activity	IDA	molecular_function
GO:0003756	protein disulfide isomera se activity	IDA	molecular_function
GO:0005161	platelet-derived growth f actor receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008305	integrin complex	TAS	cellular_component
GO:0008305	integrin complex	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010888	negative regulation of li pid storage	IMP	biological_process
GO:0014909	smooth muscle cell migrat ion	IMP	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016049	cell growth	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030168	platelet activation	IMP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	TAS	biological_process
GO:0031092	platelet alpha granule me mbrane	TAS	cellular_component
GO:0031258	lamellipodium membrane	IDA	cellular_component
GO:0031527	filopodium membrane	IDA	cellular_component
GO:0031528	microvillus membrane	IDA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0032147	activation of protein kin ase activity	IMP	biological_process
GO:0032369	negative regulation of li pid transport	IMP	biological_process
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0035295	tube development	TAS	biological_process
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0042060	wound healing	IC	biological_process
GO:0042470	melanosome	IDA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043184	vascular endothelial grow th factor receptor 2 bind ing	IPI	molecular_function
GO:0043184	vascular endothelial grow th factor receptor 2 bind ing	TAS	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0045124	regulation of bone resorp tion	TAS	biological_process
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IMP	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048333	mesodermal cell different iation	IEP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IMP	biological_process
GO:0050748	negative regulation of li poprotein metabolic proce ss	IMP	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050840	extracellular matrix bind ing	IDA	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0060055	angiogenesis involved in wound healing	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070527	platelet aggregation	IMP	biological_process
GO:0071062	alphav-beta3 integrin-vit ronectin complex	TAS	cellular_component
GO:0017134	fibroblast growth factor binding	IDA	molecular_function
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04510  Focal adhesion
hsa05418  Fluid shear stress and atherosclerosis
hsa04810  Regulation of actin cytoskeleton
hsa04380  Osteoclast differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04145  Phagosome
hsa04640  Hematopoietic cell lineage
hsa04611  Platelet activation
hsa05410  Hypertrophic cardiomyopathy
hsa04512  ECM-receptor interaction
hsa05414  Dilated cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Abnormal menustral cycle	PMID: 1378853
Adenomyosis	PMID: 24021319
Amyotrophic lateral sclerosis (ALS)	PMID: 18513389
Apoplexy	PMID: 11739968
Asthma	PMID: 15817799
Autism	PMID: 16724005
Cancer	PMID: 19876733
Cerebral palsy	PMID: 19238444
Cleft lip	PMID: 18978678
Diabetes	PMID: 17357883
Ectopic endometrium of adenomyosis	PMID: 19573311
Endometrial receptivity	PMID: 24950982
Endometriosis	PMID: 11326914
Epistaxis	PMID: 19245802
Glanzmann thrombasthenia	KEGG: H00226
Hearing loss	PMID: 17334320
Hemolytic uremic syndrome	PMID: 19110485
Hydrosalpinx	PMID: 16412752
Implantation failure	PMID: 10806750
Inflammatory bowel disease	PMID: 17111197
Lymphoproliferative disorders	PMID: 15166939
Macrothrombocytopenia	KEGG: H01740
Metabolism disorders	PMID: 14557872
Migraine disorders	PMID: 19559392
Miscarriage	PMID: 25474888
Myocardial infarction	PMID: 12071877
Nephropathy	PMID: 15627799
Obesity	PMID: 12518110
Platelet aggregation	PMID: 16133898
Polycystic ovary syndrome (PCOS)	PMID: 14669168
Female infertility	INFBASE11326914
Endometriosis	INFBASE11326914
Preeclampsia	PMID: 12716314
Primary unexplained infertility	PMID: 10806750
Restenosis	PMID: 12082592
Retinal vascular occlusion	PMID: 16905953
Systemic lupus erythematosus	PMID: 12860739
Thrombocytopenia	PMID: 12036875
Thrombophilia	PMID: 12818251
Unexplained infertility	PMID: 19205270
von Willebrand Disease	PMID: 19959486

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11326914	Endometrio sis			45 (15 endometr iotic tissues o f patients with endometriosis and 30 endometr ium from non-en dometriosis sub jects during th e same menstrua l phase)	Female infertility	Integrin beta 3 ICAM	Show abstract