Endometriosis Knowledgebase

Search Result

Gene id

3693

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ITGB5 Gene UCSC Ensembl

Gene name

integrin subunit beta 5

Alternate names

integrin beta-5, testis secretory sperm-binding protein Li 217p,

Gene location

3q21.2 (124901410: 124761947) Exons: 18 NC_000003.12

OMIM

147561

Protein Summary

Protein general information

P18084

Name: Integrin beta 5

Length: 799 Mass: 88,054

Sequence

MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGC
GGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSM
KDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTD
RVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAY
NSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFR
DSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGR
GDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKD
DQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHD
RREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD

Structural information

Protein Domains	PSI (27-76) VWFA. (136-378)
Interpro:	IPR027067 IPR033760 IPR015812 IPR014836 IPR012896 IPR002369 IPR032695 IPR016201 IPR002035
Prosite:	PS00022 PS01186 PS00243
Pfam:	PF08725 PF07965 PF00362 PF17205
MINT:	258539
STRING:	ENSP00000296181;

Other Databases

GeneCards: ITGB5; Malacards: ITGB5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006936	muscle contraction	TAS	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0034684	integrin alphav-beta5 com plex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090136	epithelial cell-cell adhe sion	IMP	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0004872	receptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006936	muscle contraction	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0034684	integrin alphav-beta5 com plex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090136	epithelial cell-cell adhe sion	IMP	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006936	muscle contraction	TAS	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0034684	integrin alphav-beta5 com plex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090136	epithelial cell-cell adhe sion	IMP	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04510  Focal adhesion
hsa04810  Regulation of actin cytoskeleton
hsa04145  Phagosome
hsa05410  Hypertrophic cardiomyopathy
hsa04512  ECM-receptor interaction
hsa05414  Dilated cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Cancer	PMID: 18550570
Endometriosis	PMID: 11917227
Endometriosis	INFBASE11917227
Polycystic ovary syndrome (PCOS)	PMID: 24279306

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11917227	Endometrio sis			52 (40 eutopic and ectopic sam ples from patie nts with endome triosis were co mpared with 12 control endomet rial samples)		alphavbeta5 integrin alphavbeta6 integrin	Show abstract