Endometriosis Knowledgebase

Search Result

Gene id

3716

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

JAK1 Gene UCSC Ensembl

Aliases

JAK1A, JAK1B, JTK3

Gene name

Janus kinase 1

Alternate names

tyrosine-protein kinase JAK1,

Gene location

1p31.3 (65067745: 64833222) Exons: 29 NC_000001.11

Gene summary(Entrez)

This gene encodes a membrane protein that is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The encoded kinase phosphorylates STAT proteins (signal transducers and activators of transcription) and plays a key role in interferon-alpha/beta and interferon-gamma signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

OMIM

147795

Protein Summary

Protein general information

P23458

Name: Tyrosine protein kinase JAK1 (EC 2.7.10.2) (Janus kinase 1) (JAK 1)

Length: 1154 Mass: 133,277

Tissue specificity: Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue. {ECO

Sequence

MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCH
NLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLL
DASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETL
NKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHI
VIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAI
NKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSH
LKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPL
DLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQ
ECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMT
RCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKI
NLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAP
ECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVY
QLMRKCWEFQPSNRTSFQNLIEGFEALLK

Structural information

Protein Domains	FERM. (34-420) SH2. (439-544) Protein (583-855) Protein (875-1153)
Interpro:	IPR019749 IPR014352 IPR019748 IPR000299 IPR011009 IPR011993 IPR000719 IPR017441 IPR001245 IPR000980 IPR008266 IPR020635 IPR016251 IPR020776
Prosite:	PS50057 PS00107 PS50011 PS00109 PS50001
Pfam:	PF07714
PDB:	3EYG 3EYH 4E4L 4E4N 4E5W 4EHZ 4EI4 4FK6 4GS0 4I5C 4IVB 4IVC 4IVD 4K6Z 4K77 4L00 4L01 5E1E 5HX8 5IXD 5IXI 5KHW 5KHX 5L04
PDBsum:	3EYG 3EYH 4E4L 4E4N 4E5W 4EHZ 4EI4 4FK6 4GS0 4I5C 4IVB 4IVC 4IVD 4K6Z 4K77 4L00 4L01 5E1E 5HX8 5IXD 5IXI 5KHW 5KHX 5L04
DIP:	133
MINT:	145830
STRING:	ENSP00000343204;

Other Databases

GeneCards: JAK1; Malacards: JAK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IBA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005131	growth hormone receptor b inding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0012505	endomembrane system	IEA	cellular_component
GO:0016477	cell migration	IBA	biological_process
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0030154	cell differentiation	IBA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IEA	molecular_function
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038110	interleukin-2-mediated si gnaling pathway	IDA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0046677	response to antibiotic	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0060338	regulation of type I inte rferon-mediated signaling pathway	TAS	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IGI	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IEA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IEA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IBA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005131	growth hormone receptor b inding	IEA	molecular_function
GO:0005131	growth hormone receptor b inding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0012505	endomembrane system	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016477	cell migration	IBA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0030154	cell differentiation	IBA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IEA	molecular_function
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038110	interleukin-2-mediated si gnaling pathway	IDA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0046677	response to antibiotic	IDA	biological_process
GO:0046777	protein autophosphorylati on	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0060338	regulation of type I inte rferon-mediated signaling pathway	TAS	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IGI	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IBA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005131	growth hormone receptor b inding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0016477	cell migration	IBA	biological_process
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0030154	cell differentiation	IBA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038110	interleukin-2-mediated si gnaling pathway	IDA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0046677	response to antibiotic	IDA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0060338	regulation of type I inte rferon-mediated signaling pathway	TAS	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IGI	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
hsa05203  Viral carcinogenesis
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05162  Measles
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04380  Osteoclast differentiation
hsa05160  Hepatitis C
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa05212  Pancreatic cancer
hsa04217  Necroptosis
PTHR24418:SF68  Angiogenesis
PTHR24418:SF68  Interferon-gamma signaling pathway
PTHR24418:SF68  Angiogenesis
PTHR24418:SF68  Interferon-gamma signaling pathway

Diseases

Associated diseases	References
Cancer	PMID: 19239328
Endometrial cancer	PMID: 27213585
Endometriosis	PMID: 15299092
Multiple sclerosis	PMID: 19604093
Ovarian endometriosis	PMID: 16815388
Ovarian endometriosis	INFBASE16815388
Endometriosis	INFBASE15299092

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15299092	Endometrio sis					PDGFRA PKC beta1 JAK1 Sprouty2 MKK7 COUP-TF2 PGE2EP	Show abstract
16815388	Endometrio sis (ovari an)					PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract