Endometriosis Knowledgebase

Search Result

Gene id

3725

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

JUN Gene UCSC Ensembl

Aliases

AP-1, AP1, c-Jun

Gene name

Jun proto-oncogene, AP-1 transcription factor subunit

Alternate names

transcription factor AP-1, Jun activation domain binding protein, activator protein 1, enhancer-binding protein AP1, jun oncogene, p39, proto-oncogene c-Jun, v-jun avian sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog,

Gene location

1p32.1 (58784112: 58780790) Exons: 1 NC_000001.11

Gene summary(Entrez)

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008]

OMIM

165160

Protein Summary

Protein general information

P05412

Name: Transcription factor AP 1 (Activator protein 1) (AP1) (Proto oncogene c Jun) (V jun avian sarcoma virus 17 oncogene homolog) (p39)

Length: 331 Mass: 35,676

Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPE
LERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASV
AGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQAL
KEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Structural information

Protein Domains	bZIP. (252-315)
Interpro:	IPR004827 IPR015558 IPR005643 IPR002112 IPR008917
Prosite:	PS50217 PS00036
Pfam:	PF00170 PF03957
PDB:	1A02 1FOS 1JNM 1JUN 1S9K 1T2K 5T01
PDBsum:	1A02 1FOS 1JNM 1JUN 1S9K 1T2K 5T01
DIP:	5961
MINT:	105756
STRING:	ENSP00000360266;

Other Databases

GeneCards: JUN; Malacards: JUN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000228	nuclear chromosome	TAS	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IBA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IC	molecular_function
GO:0000982	transcription factor acti vity, RNA polymerase II c ore promoter proximal reg ion sequence-specific bin ding	IMP	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	IC	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001774	microglial cell activatio n	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IEA	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IEA	biological_process
GO:0003151	outflow tract morphogenes is	IEA	biological_process
GO:0003677	DNA binding	TAS	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IC	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0005096	GTPase activator activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0005719	nuclear euchromatin	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007184	SMAD protein import into nucleus	IDA	biological_process
GO:0007265	Ras protein signal transd uction	IDA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009314	response to radiation	IBA	biological_process
GO:0009612	response to mechanical st imulus	IBA	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IEA	biological_process
GO:0010941	regulation of cell death	IBA	biological_process
GO:0017053	transcriptional repressor complex	IEA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030224	monocyte differentiation	IEA	biological_process
GO:0031103	axon regeneration	IEA	biological_process
GO:0031953	negative regulation of pr otein autophosphorylation	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0032870	cellular response to horm one stimulus	IBA	biological_process
GO:0034097	response to cytokine	IBA	biological_process
GO:0035026	leading edge cell differe ntiation	IEA	biological_process
GO:0035497	cAMP response element bin ding	IDA	molecular_function
GO:0035994	response to muscle stretc h	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042493	response to drug	IBA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043392	negative regulation of DN A binding	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0043923	positive regulation by ho st of viral transcription	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045597	positive regulation of ce ll differentiation	IBA	biological_process
GO:0045657	positive regulation of mo nocyte differentiation	IEA	biological_process
GO:0045740	positive regulation of DN A replication	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IC	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051365	cellular response to pota ssium ion starvation	IEA	biological_process
GO:0051591	response to cAMP	IBA	biological_process
GO:0051726	regulation of cell cycle	IBA	biological_process
GO:0051899	membrane depolarization	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IDA	biological_process
GO:0061029	eyelid development in cam era-type eye	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0071277	cellular response to calc ium ion	IEA	biological_process
GO:0071837	HMG box domain binding	IEA	molecular_function
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	ISS	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1990441	negative regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	IMP	biological_process
GO:2000144	positive regulation of DN A-templated transcription , initiation	IDA	biological_process
GO:0000228	nuclear chromosome	TAS	cellular_component
GO:0000790	nuclear chromatin	IEA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IBA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IC	molecular_function
GO:0000982	transcription factor acti vity, RNA polymerase II c ore promoter proximal reg ion sequence-specific bin ding	IMP	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	IC	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001774	microglial cell activatio n	IEA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IEA	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IEA	biological_process
GO:0003151	outflow tract morphogenes is	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IC	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0005096	GTPase activator activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0005719	nuclear euchromatin	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007184	SMAD protein import into nucleus	IDA	biological_process
GO:0007265	Ras protein signal transd uction	IDA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007612	learning	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009314	response to radiation	IBA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009612	response to mechanical st imulus	IBA	biological_process
GO:0009987	cellular process	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IEA	biological_process
GO:0010941	regulation of cell death	IBA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0017053	transcriptional repressor complex	IEA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030224	monocyte differentiation	IEA	biological_process
GO:0031103	axon regeneration	IEA	biological_process
GO:0031953	negative regulation of pr otein autophosphorylation	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0032870	cellular response to horm one stimulus	IBA	biological_process
GO:0033613	activating transcription factor binding	IEA	molecular_function
GO:0034097	response to cytokine	IEA	biological_process
GO:0034097	response to cytokine	IBA	biological_process
GO:0035026	leading edge cell differe ntiation	IEA	biological_process
GO:0035497	cAMP response element bin ding	IDA	molecular_function
GO:0035994	response to muscle stretc h	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042493	response to drug	IBA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043392	negative regulation of DN A binding	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0043923	positive regulation by ho st of viral transcription	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045597	positive regulation of ce ll differentiation	IBA	biological_process
GO:0045657	positive regulation of mo nocyte differentiation	IEA	biological_process
GO:0045740	positive regulation of DN A replication	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IC	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051365	cellular response to pota ssium ion starvation	IEA	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051591	response to cAMP	IBA	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0051726	regulation of cell cycle	IBA	biological_process
GO:0051899	membrane depolarization	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IDA	biological_process
GO:0061029	eyelid development in cam era-type eye	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0071277	cellular response to calc ium ion	IEA	biological_process
GO:0071837	HMG box domain binding	IEA	molecular_function
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IEA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	ISS	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1990441	negative regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	IMP	biological_process
GO:2000144	positive regulation of DN A-templated transcription , initiation	IDA	biological_process
GO:0000228	nuclear chromosome	TAS	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IBA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IC	molecular_function
GO:0000982	transcription factor acti vity, RNA polymerase II c ore promoter proximal reg ion sequence-specific bin ding	IMP	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	IC	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IC	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0005096	GTPase activator activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0005719	nuclear euchromatin	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007184	SMAD protein import into nucleus	IDA	biological_process
GO:0007265	Ras protein signal transd uction	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0009314	response to radiation	IBA	biological_process
GO:0009612	response to mechanical st imulus	IBA	biological_process
GO:0010941	regulation of cell death	IBA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0032870	cellular response to horm one stimulus	IBA	biological_process
GO:0034097	response to cytokine	IBA	biological_process
GO:0035497	cAMP response element bin ding	IDA	molecular_function
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042493	response to drug	IBA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043392	negative regulation of DN A binding	IDA	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0043923	positive regulation by ho st of viral transcription	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045597	positive regulation of ce ll differentiation	IBA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IC	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051591	response to cAMP	IBA	biological_process
GO:0051726	regulation of cell cycle	IBA	biological_process
GO:0060395	SMAD protein signal trans duction	IDA	biological_process
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	ISS	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1990441	negative regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	IMP	biological_process
GO:2000144	positive regulation of DN A-templated transcription , initiation	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa04010  MAPK signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa05224  Breast cancer
PTHR11462:SF8  T cell activation
hsa05164  Influenza A
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
PTHR11462:SF8  B cell activation
hsa05142  Chagas disease
hsa01522  Endocrine resistance
PTHR11462:SF8  CCKR signaling map
hsa04657  IL-17 signaling pathway
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa04024  cAMP signaling pathway
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04722  Neurotrophin signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04915  Estrogen signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa05133  Pertussis
hsa05210  Colorectal cancer
PTHR11462:SF8  B cell activation
hsa04012  ErbB signaling pathway
PTHR11462:SF8  B cell activation
hsa05132  Salmonella infection
hsa05211  Renal cell carcinoma
hsa05231  Choline metabolism in cancer
hsa04310  Wnt signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04912  GnRH signaling pathway
hsa04530  Tight junction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04662  B cell receptor signaling pathway
hsa04137  Mitophagy - animal
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
PTHR11462:SF8  CCKR signaling map
PTHR11462:SF8  CCKR signaling map
PTHR11462:SF8  T cell activation
PTHR11462:SF8  T cell activation
PTHR11462:SF8  CCKR signaling map
PTHR11462:SF8  CCKR signaling map
PTHR11462:SF8  T cell activation
PTHR11462:SF8  B cell activation
PTHR11462:SF8  T cell activation
PTHR11462:SF8  CCKR signaling map
PTHR11462:SF8  T cell activation
PTHR11462:SF8  B cell activation
PTHR11462:SF8  B cell activation

Diseases

Associated diseases	References
Cancer	PMID: 18950845
Crohn's disease	PMID: 19249008
Endometriosis	PMID: 15501904
Endometriosis	INFBASE15501904
Polycystic ovary syndrome (PCOS)	PMID: 22344199
Preeclampsia	PMID: 24931237

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15501904	Endometrio sis			366 (157 contro l subjects, 209 patients with endometriosis)		FOXO1 c-jun	Show abstract