Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3732
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CD82   Gene   UCSC   Ensembl
Aliases 4F9, C33, GR15, IA4, KAI1, R2, SAR2, ST6, TSPAN27
Gene name CD82 molecule
Alternate names CD82 antigen, C33 antigen, inducible membrane protein R2, kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)), metastasis suppressor Kangai-1, tetraspanin-27, tspan-27,
Gene location 11p11.2 (44565590: 44620362)     Exons: 12     NC_000011.10
Gene summary(Entrez) This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
OMIM 600623

Protein Summary

Protein general information P27701  

Name: CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai 1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin 27) (Tspan 27) (CD antigen CD82)

Length: 267  Mass: 29,626

Tissue specificity: Lymphoid specific.

Sequence MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCI
GAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCC
GWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQ
ENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Structural information
Interpro:  IPR000301 IPR018499 IPR018503 IPR008952
Prosite:   PS00421

Pfam:  
PF00335
MINT:   1432537
STRING:   ENSP00000227155;
Other Databases GeneCards:  CD82;  Malacards:  CD82

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular_function
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007166 cell surface receptor sig
naling pathway
IBA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0005515 protein binding
IPI molecular_function
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007166 cell surface receptor sig
naling pathway
IBA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0005515 protein binding
IPI molecular_function
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007166 cell surface receptor sig
naling pathway
IBA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component

KEGG pathways

hsa04115  p53 signaling pathway

Diseases

Associated diseases References
Endometriosis PMID: 21685244
Prostate cancer OMIM: 600623
Endometriosis INFBASE21685244

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
26918694 Endometrio
sis

67 (38 patients
with endometri
osis, 29 withou
t endometriosis
)

Show abstract
21685244 Endometrio
sis


CD82
Show abstract