Endometriosis Knowledgebase

Search Result

Gene id

3791

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KDR Gene UCSC Ensembl

Aliases

CD309, FLK1, VEGFR, VEGFR2

Gene name

kinase insert domain receptor

Alternate names

vascular endothelial growth factor receptor 2, fetal liver kinase-1, kinase insert domain receptor (a type III receptor tyrosine kinase), protein-tyrosine kinase receptor Flk-1, soluble VEGFR2, tyrosine kinase growth factor receptor,

Gene location

4q12 (55125594: 55078258) Exons: 30 NC_000004.12

Gene summary(Entrez)

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas. [provided by RefSeq, May 2009]

OMIM

191306

Protein Summary

Protein general information

P35968

Name: Vascular endothelial growth factor receptor 2 (VEGFR 2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK 1) (Kinase insert domain receptor) (KDR) (Protein tyrosine kinase receptor flk 1) (CD antigen CD309)

Length: 1356 Mass: 151,527

Tissue specificity: Detected in cornea (at protein level). Widely expressed. {ECO

Sequence

MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVE
VTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPC
LGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYD
VVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNH
TIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAI
PPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVS
ALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLEN
QTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEA
FFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDAS
KWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASS
GFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA
RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRM
RAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDR
TKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTT
LSSPPV

Structural information

Protein Domains	Ig-like (46-110) Ig-like (141-207) Ig-like (224-320) Ig-like (328-414) Ig-like (421-548) Ig-like (551-660) Ig-like (667-753) (834-)
Interpro:	IPR007110 IPR013783 IPR013098 IPR003599 IPR003598 IPR013151 IPR011009 IPR000719 IPR017441 IPR001245 IPR008266 IPR020635 IPR001824 IPR009136
Prosite:	PS50835 PS00107 PS50011 PS00109 PS00240
Pfam:	PF07679 PF00047 PF07714
PDB:	1VR2 1Y6A 1Y6B 1YWN 2M59 2MET 2MEU 2OH4 2P2H 2P2I 2QU5 2QU6 2RL5 2X1W 2X1X 2XIR 3B8Q 3B8R 3BE2 3C7Q 3CJF 3CJG 3CP9 3CPB 3CPC 3DTW 3EFL 3EWH 3KVQ 3S35 3S36 3S37 3U6J 3V2A 3V6B 3VHE 3VHK 3VID 3VNT 3VO3 3WZD 3WZE 4AG8 4AGC 4AGD 4ASD 4ASE 5EW3
PDBsum:	1VR2 1Y6A 1Y6B 1YWN 2M59 2MET 2MEU 2OH4 2P2H 2P2I 2QU5 2QU6 2RL5 2X1W 2X1X 2XIR 3B8Q 3B8R 3BE2 3C7Q 3CJF 3CJG 3CP9 3CPB 3CPC 3DTW 3EFL 3EWH 3KVQ 3S35 3S36 3S37 3U6J 3V2A 3V6B 3VHE 3VHK 3VID 3VNT 3VO3 3WZD 3WZE 4AG8 4AGC 4AGD 4ASD 4ASE 5EW3
DIP:	486
MINT:	127732
STRING:	ENSP00000263923;

Other Databases

GeneCards: KDR; Malacards: KDR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	TAS	biological_process
GO:0001570	vasculogenesis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	ISS	biological_process
GO:0003158	endothelium development	ISS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0004716	signal transducer, downst ream of receptor, with pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005769	early endosome	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008360	regulation of cell shape	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016239	positive regulation of ma croautophagy	IGI	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0023014	signal transduction by pr otein phosphorylation	IEA	biological_process
GO:0030054	cell junction	ISS	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0035162	embryonic hemopoiesis	ISS	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0038033	positive regulation of en dothelial cell chemotaxis by VEGF-activated vascul ar endothelial growth fac tor receptor signaling pa thway	IDA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	ISS	biological_process
GO:0038085	vascular endothelial grow th factor binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IMP	biological_process
GO:0051879	Hsp90 protein binding	TAS	molecular_function
GO:0051894	positive regulation of fo cal adhesion assembly	IDA	biological_process
GO:0051901	positive regulation of mi tochondrial depolarizatio n	IGI	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0090141	positive regulation of mi tochondrial fission	IGI	biological_process
GO:0097443	sorting endosome	ISS	cellular_component
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2001214	positive regulation of va sculogenesis	ISS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001570	vasculogenesis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	ISS	biological_process
GO:0003158	endothelium development	ISS	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0004716	signal transducer, downst ream of receptor, with pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005769	early endosome	ISS	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008360	regulation of cell shape	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016239	positive regulation of ma croautophagy	IGI	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IEA	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0023014	signal transduction by pr otein phosphorylation	IEA	biological_process
GO:0030054	cell junction	ISS	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030154	cell differentiation	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0035162	embryonic hemopoiesis	ISS	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0038033	positive regulation of en dothelial cell chemotaxis by VEGF-activated vascul ar endothelial growth fac tor receptor signaling pa thway	IDA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	ISS	biological_process
GO:0038085	vascular endothelial grow th factor binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IMP	biological_process
GO:0051879	Hsp90 protein binding	TAS	molecular_function
GO:0051894	positive regulation of fo cal adhesion assembly	IDA	biological_process
GO:0051901	positive regulation of mi tochondrial depolarizatio n	IGI	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0090141	positive regulation of mi tochondrial fission	IGI	biological_process
GO:0097443	sorting endosome	ISS	cellular_component
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2001214	positive regulation of va sculogenesis	ISS	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001570	vasculogenesis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	ISS	biological_process
GO:0003158	endothelium development	ISS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0004716	signal transducer, downst ream of receptor, with pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005768	endosome	IDA	cellular_component
GO:0005769	early endosome	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008360	regulation of cell shape	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IGI	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0030054	cell junction	ISS	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0035162	embryonic hemopoiesis	ISS	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0038033	positive regulation of en dothelial cell chemotaxis by VEGF-activated vascul ar endothelial growth fac tor receptor signaling pa thway	IDA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	ISS	biological_process
GO:0038085	vascular endothelial grow th factor binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IMP	biological_process
GO:0051879	Hsp90 protein binding	TAS	molecular_function
GO:0051894	positive regulation of fo cal adhesion assembly	IDA	biological_process
GO:0051901	positive regulation of mi tochondrial depolarizatio n	IGI	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0090141	positive regulation of mi tochondrial fission	IGI	biological_process
GO:0097443	sorting endosome	ISS	cellular_component
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2001214	positive regulation of va sculogenesis	ISS	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa05418  Fluid shear stress and atherosclerosis
hsa04144  Endocytosis
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04370  VEGF signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 16630933
Cancer	PMID: 16807673
Endometriosis	PMID: 16179118
Female infertility	PMID: 26411207
Hemangioma	OMIM: 191306
Infantile hemangioma	KEGG: H01482, OMIM: 191306
Kawasaki disease	PMID: 15470196
Lymphedema	PMID: 18564921
Macular degeneration	PMID: 20019880
Male infertility	PMID: 10438994
Mullerian anomaly	PMID: 19200976
Oocyte maturation	PMID: 26411207
Ovarian hyperstimulation syndrome(OHSS)	PMID: 24886133
Tubal infertility	INFBASE21733043
Deeply infiltrating endometriosis	INFBASE17765237
Endometriosis	INFBASE8755660
Premature ovarian failure ( POF)	PMID: 22510937
Sarcoidosis	PMID: 19741061
Stroke	PMID: 19520980
Uterine anomalies	PMID: 19200976

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Associated_genes	Abstract
17765237	Endometrio sis			62 (30 women wi th endometriosi s (10 ovarian, 10 bladder, 10 rectal), 32 con trol women (10 proliferative e ndometrium, 10 secretory endom etrium, 4 norma l ovary, 4 norm al bladder, 4 n ormal rectum))	VEGF Flk-1	Show abstract
16179118	Endometrio sis			157 (37 specime ns of entopic e ndometrium, 34 specimens of ov arian chocolate cyst, 34 speci mens of ovarian chocolate cyst , 15 specimens of red peritone al endometriosi s lesions, 4 ab dominal wall en dometriosis les ions, 33 patien ts with other g ynecological di		Show abstract
8755660	Endometrio sis				FLT1 KDR VEGFA	Show abstract
21733043	Endometrio sis			40 (20 women wi th endometriosi s III or IV, 20 with tubal inf ertility only ( control group) )		Show abstract
23635398	Endometrio sis	VEGFR-2 (1719T/A, 1192C/T, +31C/T, IVS25-92A/G and IVS6+?54C/T)		1151 (571 patie nts with endome triosis, 580 wo men in the cont rol group)	VEGFR-2	Show abstract
16940291	Endometrio sis			39 (25 women wi th endometriosi s, 14 women wit hout endometrio sis)	VEGF VEGFR-2	Show abstract
27836223	Endometrio sis	VEGF (-2578C>A, -460T>C, -1154G>A, +405G>C and +936C>T), VEGFR2 (-604T>C, 1192C>T)	Brazili an	516 (293 endome triosis patient s, 223 controls )		Show abstract