Endometriosis Knowledgebase

Search Result

Gene id

3814

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KISS1 Gene UCSC Ensembl

Aliases

HH13, KiSS-1

Gene name

KiSS-1 metastasis suppressor

Alternate names

metastasis-suppressor KiSS-1, kisspeptin-1, malignant melanoma metastasis-suppressor, metastin, prepro-kisspeptin,

Gene location

1q32.1 (204196490: 204190340) Exons: 3 NC_000001.11

Gene summary(Entrez)

This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues. [provided by RefSeq, Mar 2012]

OMIM

603286

Protein Summary

Protein general information

Q15726

Name: Metastasis-suppressor KiSS-1 (Kisspeptin-1) [Cleaved into: Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10]

Length: 138 Mass: 14,705

Tissue specificity: Very high expression in placenta, with the next highest level in testis and moderate levels in pancreas, liver, small intestine and brain at much lower levels. Expression levels increased in both early placentas and molar pregnancies a

Sequence

MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTSLSPPP
ESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG

Structural information

Interpro:	IPR020207
Pfam:	PF15152
STRING:	ENSP00000356162;

Other Databases

GeneCards: KISS1; Malacards: KISS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0007010	cytoskeleton organization	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0031773	kisspeptin receptor bindi ng	IEA	molecular_function
GO:0033686	positive regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0050806	positive regulation of sy naptic transmission	IEA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IEA	biological_process
GO:0060112	generation of ovulation c ycle rhythm	IEA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0007010	cytoskeleton organization	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0031773	kisspeptin receptor bindi ng	IEA	molecular_function
GO:0033686	positive regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0050806	positive regulation of sy naptic transmission	IEA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IEA	biological_process
GO:0060112	generation of ovulation c ycle rhythm	IEA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0007010	cytoskeleton organization	TAS	biological_process

Diseases

Associated diseases	References
Endometriosis	INFBASE26918694
?Hypogonadotropic hypogonadism 13 with or without anosmia	OMIM603286
Hypogonadotropic hypogonadism	KEGGH00255

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26918694	Endometrio sis			67 (38 patients with endometri osis, 29 withou t endometriosis )			Show abstract