Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 387
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol RHOA   Gene   UCSC   Ensembl
Aliases ARH12, ARHA, RHO12, RHOH12
Gene name ras homolog family member A
Alternate names transforming protein RhoA, Aplysia ras-related homolog 12, oncogene RHO H12, small GTP binding protein RhoA,
Gene location 3p21.31 (49412096: 49359135)     Exons: 7     NC_000003.12
Gene summary(Entrez) This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
OMIM 165390

Protein Summary

Protein general information P61586  

Name: Transforming protein RhoA (Rho cDNA clone 12) (h12)

Length: 193  Mass: 21,768

Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYP
DTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR
IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Structural information

Motifs
Effector region.(34-42)
Interpro:  IPR027417 IPR005225 IPR001806 IPR003578
Prosite:   PS51420

Pfam:  
PF00071

PDB:  
1A2B 1CC0 1CXZ 1DPF 1FTN 1KMQ 1LB1 1OW3 1S1C 1TX4 1X86 1XCG 2RGN 3KZ1 3LW8 3LWN 3LXR 3MSX 3T06 4D0N 4XH9 4XOI 4XSG 4XSH 5A0F 5BWM 5C2K 5C4M 5EZ6 5FR1 5FR2 5HPY 5IRC 5JCP 5JHG 5JHH 5M6X 5M70 6BC0 6BCA 6BCB
PDBsum:   1A2B 1CC0 1CXZ 1DPF 1FTN 1KMQ 1LB1 1OW3 1S1C 1TX4 1X86 1XCG 2RGN 3KZ1 3LW8 3LWN 3LXR 3MSX 3T06 4D0N 4XH9 4XOI 4XSG 4XSH 5A0F 5BWM 5C2K 5C4M 5EZ6 5FR1 5FR2 5HPY 5IRC 5JCP 5JHG 5JHH 5M6X 5M70 6BC0 6BCA 6BCB

DIP:  
29642
MINT:  
STRING:   ENSP00000400175;
Other Databases GeneCards:  RHOA;  Malacards:  RHOA

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0003924 GTPase activity
TAS molecular_function
GO:0003924 GTPase activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005768 endosome
IMP cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005925 focal adhesion
IDA cellular_component
GO:0005938 cell cortex
IDA cellular_component
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
TAS biological_process
GO:0007266 Rho protein signal transd
uction
TAS biological_process
GO:0007266 Rho protein signal transd
uction
IDA biological_process
GO:0016032 viral process
IEA biological_process
GO:0016477 cell migration
IMP biological_process
GO:0016477 cell migration
IDA biological_process
GO:0017022 myosin binding
IPI molecular_function
GO:0021762 substantia nigra developm
ent
IEP biological_process
GO:0030027 lamellipodium
ISS cellular_component
GO:0030036 actin cytoskeleton organi
zation
TAS biological_process
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030168 platelet activation
TAS biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030496 midbody
IEA cellular_component
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IDA cellular_component
GO:0031532 actin cytoskeleton reorga
nization
IMP biological_process
GO:0031982 vesicle
IDA cellular_component
GO:0032467 positive regulation of cy
tokinesis
IMP biological_process
GO:0032467 positive regulation of cy
tokinesis
IMP biological_process
GO:0032956 regulation of actin cytos
keleton organization
IDA biological_process
GO:0033688 regulation of osteoblast
proliferation
ISS biological_process
GO:0035385 Roundabout signaling path
way
IDA biological_process
GO:0036089 cleavage furrow formation
IDA biological_process
GO:0038027 apolipoprotein A-I-mediat
ed signaling pathway
IMP biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
NAS biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
IEP biological_process
GO:0043149 stress fiber assembly
IMP biological_process
GO:0043296 apical junction complex
IDA cellular_component
GO:0043297 apical junction assembly
IMP biological_process
GO:0043542 endothelial cell migratio
n
IGI biological_process
GO:0043931 ossification involved in
bone maturation
ISS biological_process
GO:0044319 wound healing, spreading
of cells
ISS biological_process
GO:0045666 positive regulation of ne
uron differentiation
IMP biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological_process
GO:0050771 negative regulation of ax
onogenesis
TAS biological_process
GO:0050772 positive regulation of ax
onogenesis
TAS biological_process
GO:0050919 negative chemotaxis
IMP biological_process
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
TAS biological_process
GO:0051496 positive regulation of st
ress fiber assembly
IDA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
NAS biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
TAS biological_process
GO:0060193 positive regulation of li
pase activity
IDA biological_process
GO:0060193 positive regulation of li
pase activity
IMP biological_process
GO:0061383 trabecula morphogenesis
ISS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0071944 cell periphery
IMP cellular_component
GO:0090051 negative regulation of ce
ll migration involved in
sprouting angiogenesis
IGI biological_process
GO:0090307 mitotic spindle assembly
IMP biological_process
GO:0097498 endothelial tube lumen ex
tension
IGI biological_process
GO:1902766 skeletal muscle satellite
cell migration
ISS biological_process
GO:1903673 mitotic cleavage furrow f
ormation
IMP biological_process
GO:2000145 regulation of cell motili
ty
TAS biological_process
GO:0032154 cleavage furrow
IDA cellular_component
GO:0000166 nucleotide binding
IEA molecular_function
GO:0003924 GTPase activity
TAS molecular_function
GO:0003924 GTPase activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005737 cytoplasm
IEA cellular_component
GO:0005768 endosome
IMP cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005925 focal adhesion
IDA cellular_component
GO:0005938 cell cortex
IEA cellular_component
GO:0005938 cell cortex
IDA cellular_component
GO:0007049 cell cycle
IEA biological_process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
TAS biological_process
GO:0007264 small GTPase mediated sig
nal transduction
IEA biological_process
GO:0007266 Rho protein signal transd
uction
TAS biological_process
GO:0007266 Rho protein signal transd
uction
IDA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016032 viral process
IEA biological_process
GO:0016477 cell migration
IMP biological_process
GO:0016477 cell migration
IDA biological_process
GO:0017022 myosin binding
IPI molecular_function
GO:0021762 substantia nigra developm
ent
IEP biological_process
GO:0030027 lamellipodium
ISS cellular_component
GO:0030027 lamellipodium
IEA cellular_component
GO:0030036 actin cytoskeleton organi
zation
TAS biological_process
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030168 platelet activation
TAS biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0030496 midbody
IEA cellular_component
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IDA cellular_component
GO:0031532 actin cytoskeleton reorga
nization
IMP biological_process
GO:0031982 vesicle
IDA cellular_component
GO:0032154 cleavage furrow
IEA cellular_component
GO:0032467 positive regulation of cy
tokinesis
IMP biological_process
GO:0032467 positive regulation of cy
tokinesis
IMP biological_process
GO:0032956 regulation of actin cytos
keleton organization
IDA biological_process
GO:0033688 regulation of osteoblast
proliferation
ISS biological_process
GO:0035385 Roundabout signaling path
way
IDA biological_process
GO:0036089 cleavage furrow formation
IDA biological_process
GO:0038027 apolipoprotein A-I-mediat
ed signaling pathway
IMP biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
NAS biological_process
GO:0042995 cell projection
IEA cellular_component
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
IEP biological_process
GO:0043149 stress fiber assembly
IMP biological_process
GO:0043296 apical junction complex
IDA cellular_component
GO:0043297 apical junction assembly
IMP biological_process
GO:0043542 endothelial cell migratio
n
IGI biological_process
GO:0043931 ossification involved in
bone maturation
ISS biological_process
GO:0044319 wound healing, spreading
of cells
ISS biological_process
GO:0045666 positive regulation of ne
uron differentiation
IMP biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological_process
GO:0050771 negative regulation of ax
onogenesis
TAS biological_process
GO:0050772 positive regulation of ax
onogenesis
TAS biological_process
GO:0050919 negative chemotaxis
IMP biological_process
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
TAS biological_process
GO:0051301 cell division
IEA biological_process
GO:0051496 positive regulation of st
ress fiber assembly
IDA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
NAS biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
TAS biological_process
GO:0060193 positive regulation of li
pase activity
IDA biological_process
GO:0060193 positive regulation of li
pase activity
IMP biological_process
GO:0061383 trabecula morphogenesis
ISS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0071944 cell periphery
IMP cellular_component
GO:0090051 negative regulation of ce
ll migration involved in
sprouting angiogenesis
IGI biological_process
GO:0090307 mitotic spindle assembly
IMP biological_process
GO:0097498 endothelial tube lumen ex
tension
IGI biological_process
GO:1902766 skeletal muscle satellite
cell migration
ISS biological_process
GO:1903673 mitotic cleavage furrow f
ormation
IMP biological_process
GO:2000145 regulation of cell motili
ty
TAS biological_process
GO:0032154 cleavage furrow
IDA cellular_component
GO:0003924 GTPase activity
TAS molecular_function
GO:0003924 GTPase activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005525 GTP binding
IDA molecular_function
GO:0005768 endosome
IMP cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005925 focal adhesion
IDA cellular_component
GO:0005938 cell cortex
IDA cellular_component
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
TAS biological_process
GO:0007266 Rho protein signal transd
uction
TAS biological_process
GO:0007266 Rho protein signal transd
uction
IDA biological_process
GO:0016477 cell migration
IMP biological_process
GO:0016477 cell migration
IDA biological_process
GO:0017022 myosin binding
IPI molecular_function
GO:0021762 substantia nigra developm
ent
IEP biological_process
GO:0030027 lamellipodium
ISS cellular_component
GO:0030036 actin cytoskeleton organi
zation
TAS biological_process
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030054 cell junction
TAS cellular_component
GO:0030168 platelet activation
TAS biological_process
GO:0030334 regulation of cell migrat
ion
IMP biological_process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IDA cellular_component
GO:0031532 actin cytoskeleton reorga
nization
IMP biological_process
GO:0031982 vesicle
IDA cellular_component
GO:0032467 positive regulation of cy
tokinesis
IMP biological_process
GO:0032467 positive regulation of cy
tokinesis
IMP biological_process
GO:0032956 regulation of actin cytos
keleton organization
IDA biological_process
GO:0033688 regulation of osteoblast
proliferation
ISS biological_process
GO:0035385 Roundabout signaling path
way
IDA biological_process
GO:0036089 cleavage furrow formation
IDA biological_process
GO:0038027 apolipoprotein A-I-mediat
ed signaling pathway
IMP biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
NAS biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
IEP biological_process
GO:0043149 stress fiber assembly
IMP biological_process
GO:0043296 apical junction complex
IDA cellular_component
GO:0043297 apical junction assembly
IMP biological_process
GO:0043542 endothelial cell migratio
n
IGI biological_process
GO:0043931 ossification involved in
bone maturation
ISS biological_process
GO:0044319 wound healing, spreading
of cells
ISS biological_process
GO:0045666 positive regulation of ne
uron differentiation
IMP biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological_process
GO:0050771 negative regulation of ax
onogenesis
TAS biological_process
GO:0050772 positive regulation of ax
onogenesis
TAS biological_process
GO:0050919 negative chemotaxis
IMP biological_process
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
TAS biological_process
GO:0051496 positive regulation of st
ress fiber assembly
IDA biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
NAS biological_process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
TAS biological_process
GO:0060193 positive regulation of li
pase activity
IDA biological_process
GO:0060193 positive regulation of li
pase activity
IMP biological_process
GO:0061383 trabecula morphogenesis
ISS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0071944 cell periphery
IMP cellular_component
GO:0090051 negative regulation of ce
ll migration involved in
sprouting angiogenesis
IGI biological_process
GO:0090307 mitotic spindle assembly
IMP biological_process
GO:0097498 endothelial tube lumen ex
tension
IGI biological_process
GO:1902766 skeletal muscle satellite
cell migration
ISS biological_process
GO:1903673 mitotic cleavage furrow f
ormation
IMP biological_process
GO:2000145 regulation of cell motili
ty
TAS biological_process
GO:0032154 cleavage furrow
IDA cellular_component

KEGG pathways

hsa05100  Bacterial invasion of epithelial cells
hsa05152  Tuberculosis
hsa05133  Pertussis
hsa05130  Pathogenic Escherichia coli infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05210  Colorectal cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05200  Pathways in cancer
hsa04360  Axon guidance
hsa04722  Neurotrophin signaling pathway
hsa04972  Pancreatic secretion
hsa04270  Vascular smooth muscle contraction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04921  Oxytocin signaling pathway
hsa04062  Chemokine signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04660  T cell receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04530  Tight junction
hsa04520  Adherens junction
hsa04510  Focal adhesion
hsa04144  Endocytosis
hsa04150  mTOR signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04310  Wnt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway

Diseases

Associated diseases References
Crohn's disease GAD20307617
Endometriosis PubMed21303778

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21303778 Endometrio
sis

30(16 patients
with endometrio
sis, 14 endomet
riosis free con
trols)

Show abstract
17204524 Endometrio
sis



Show abstract