Endometriosis Knowledgebase

Search Result

Gene id

387

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RHOA Gene UCSC Ensembl

Aliases

ARH12, ARHA, RHO12, RHOH12

Gene name

ras homolog family member A

Alternate names

transforming protein RhoA, Aplysia ras-related homolog 12, oncogene RHO H12, small GTP binding protein RhoA,

Gene location

3p21.31 (49412096: 49359135) Exons: 7 NC_000003.12

Gene summary(Entrez)

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]

OMIM

165390

Protein Summary

Protein general information

P61586

Name: Transforming protein RhoA (Rho cDNA clone 12) (h12)

Length: 193 Mass: 21,768

Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYP
DTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR
IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Structural information

Motifs	Effector region.(34-42)
Interpro:	IPR027417 IPR005225 IPR001806 IPR003578
Prosite:	PS51420
Pfam:	PF00071
PDB:	1A2B 1CC0 1CXZ 1DPF 1FTN 1KMQ 1LB1 1OW3 1S1C 1TX4 1X86 1XCG 2RGN 3KZ1 3LW8 3LWN 3LXR 3MSX 3T06 4D0N 4XH9 4XOI 4XSG 4XSH 5A0F 5BWM 5C2K 5C4M 5EZ6 5FR1 5FR2 5HPY 5IRC 5JCP 5JHG 5JHH 5M6X 5M70 6BC0 6BCA 6BCB
PDBsum:	1A2B 1CC0 1CXZ 1DPF 1FTN 1KMQ 1LB1 1OW3 1S1C 1TX4 1X86 1XCG 2RGN 3KZ1 3LW8 3LWN 3LXR 3MSX 3T06 4D0N 4XH9 4XOI 4XSG 4XSH 5A0F 5BWM 5C2K 5C4M 5EZ6 5FR1 5FR2 5HPY 5IRC 5JCP 5JHG 5JHH 5M6X 5M70 6BC0 6BCA 6BCB
DIP:	29642
MINT:
STRING:	ENSP00000400175;

Other Databases

GeneCards: RHOA; Malacards: RHOA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	TAS	molecular_function
GO:0003924	GTPase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IDA	molecular_function
GO:0005525	GTP binding	IDA	molecular_function
GO:0005768	endosome	IMP	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005938	cell cortex	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007266	Rho protein signal transd uction	TAS	biological_process
GO:0007266	Rho protein signal transd uction	IDA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0017022	myosin binding	IPI	molecular_function
GO:0021762	substantia nigra developm ent	IEP	biological_process
GO:0030027	lamellipodium	ISS	cellular_component
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030168	platelet activation	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IMP	biological_process
GO:0030496	midbody	IEA	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0031532	actin cytoskeleton reorga nization	IMP	biological_process
GO:0031982	vesicle	IDA	cellular_component
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032956	regulation of actin cytos keleton organization	IDA	biological_process
GO:0033688	regulation of osteoblast proliferation	ISS	biological_process
GO:0035385	Roundabout signaling path way	IDA	biological_process
GO:0036089	cleavage furrow formation	IDA	biological_process
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	NAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043296	apical junction complex	IDA	cellular_component
GO:0043297	apical junction assembly	IMP	biological_process
GO:0043542	endothelial cell migratio n	IGI	biological_process
GO:0043931	ossification involved in bone maturation	ISS	biological_process
GO:0044319	wound healing, spreading of cells	ISS	biological_process
GO:0045666	positive regulation of ne uron differentiation	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050771	negative regulation of ax onogenesis	TAS	biological_process
GO:0050772	positive regulation of ax onogenesis	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0051056	regulation of small GTPas e mediated signal transdu ction	TAS	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IDA	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	NAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0060193	positive regulation of li pase activity	IDA	biological_process
GO:0060193	positive regulation of li pase activity	IMP	biological_process
GO:0061383	trabecula morphogenesis	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0071944	cell periphery	IMP	cellular_component
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IGI	biological_process
GO:0090307	mitotic spindle assembly	IMP	biological_process
GO:0097498	endothelial tube lumen ex tension	IGI	biological_process
GO:1902766	skeletal muscle satellite cell migration	ISS	biological_process
GO:1903673	mitotic cleavage furrow f ormation	IMP	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0032154	cleavage furrow	IDA	cellular_component
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0003924	GTPase activity	TAS	molecular_function
GO:0003924	GTPase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	IDA	molecular_function
GO:0005525	GTP binding	IDA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005768	endosome	IMP	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0005938	cell cortex	IDA	cellular_component
GO:0007049	cell cycle	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0007266	Rho protein signal transd uction	TAS	biological_process
GO:0007266	Rho protein signal transd uction	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0017022	myosin binding	IPI	molecular_function
GO:0021762	substantia nigra developm ent	IEP	biological_process
GO:0030027	lamellipodium	ISS	cellular_component
GO:0030027	lamellipodium	IEA	cellular_component
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030168	platelet activation	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IMP	biological_process
GO:0030496	midbody	IEA	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0031532	actin cytoskeleton reorga nization	IMP	biological_process
GO:0031982	vesicle	IDA	cellular_component
GO:0032154	cleavage furrow	IEA	cellular_component
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032956	regulation of actin cytos keleton organization	IDA	biological_process
GO:0033688	regulation of osteoblast proliferation	ISS	biological_process
GO:0035385	Roundabout signaling path way	IDA	biological_process
GO:0036089	cleavage furrow formation	IDA	biological_process
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	NAS	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043296	apical junction complex	IDA	cellular_component
GO:0043297	apical junction assembly	IMP	biological_process
GO:0043542	endothelial cell migratio n	IGI	biological_process
GO:0043931	ossification involved in bone maturation	ISS	biological_process
GO:0044319	wound healing, spreading of cells	ISS	biological_process
GO:0045666	positive regulation of ne uron differentiation	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050771	negative regulation of ax onogenesis	TAS	biological_process
GO:0050772	positive regulation of ax onogenesis	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0051056	regulation of small GTPas e mediated signal transdu ction	TAS	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IDA	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	NAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0060193	positive regulation of li pase activity	IDA	biological_process
GO:0060193	positive regulation of li pase activity	IMP	biological_process
GO:0061383	trabecula morphogenesis	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0071944	cell periphery	IMP	cellular_component
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IGI	biological_process
GO:0090307	mitotic spindle assembly	IMP	biological_process
GO:0097498	endothelial tube lumen ex tension	IGI	biological_process
GO:1902766	skeletal muscle satellite cell migration	ISS	biological_process
GO:1903673	mitotic cleavage furrow f ormation	IMP	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0032154	cleavage furrow	IDA	cellular_component
GO:0003924	GTPase activity	TAS	molecular_function
GO:0003924	GTPase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IDA	molecular_function
GO:0005525	GTP binding	IDA	molecular_function
GO:0005768	endosome	IMP	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005938	cell cortex	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007266	Rho protein signal transd uction	TAS	biological_process
GO:0007266	Rho protein signal transd uction	IDA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0017022	myosin binding	IPI	molecular_function
GO:0021762	substantia nigra developm ent	IEP	biological_process
GO:0030027	lamellipodium	ISS	cellular_component
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030168	platelet activation	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IMP	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0031532	actin cytoskeleton reorga nization	IMP	biological_process
GO:0031982	vesicle	IDA	cellular_component
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032956	regulation of actin cytos keleton organization	IDA	biological_process
GO:0033688	regulation of osteoblast proliferation	ISS	biological_process
GO:0035385	Roundabout signaling path way	IDA	biological_process
GO:0036089	cleavage furrow formation	IDA	biological_process
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	NAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043296	apical junction complex	IDA	cellular_component
GO:0043297	apical junction assembly	IMP	biological_process
GO:0043542	endothelial cell migratio n	IGI	biological_process
GO:0043931	ossification involved in bone maturation	ISS	biological_process
GO:0044319	wound healing, spreading of cells	ISS	biological_process
GO:0045666	positive regulation of ne uron differentiation	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050771	negative regulation of ax onogenesis	TAS	biological_process
GO:0050772	positive regulation of ax onogenesis	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0051056	regulation of small GTPas e mediated signal transdu ction	TAS	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IDA	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	NAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0060193	positive regulation of li pase activity	IDA	biological_process
GO:0060193	positive regulation of li pase activity	IMP	biological_process
GO:0061383	trabecula morphogenesis	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0071944	cell periphery	IMP	cellular_component
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IGI	biological_process
GO:0090307	mitotic spindle assembly	IMP	biological_process
GO:0097498	endothelial tube lumen ex tension	IGI	biological_process
GO:1902766	skeletal muscle satellite cell migration	ISS	biological_process
GO:1903673	mitotic cleavage furrow f ormation	IMP	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0032154	cleavage furrow	IDA	cellular_component

KEGG pathways

hsa05100  Bacterial invasion of epithelial cells
hsa05152  Tuberculosis
hsa05133  Pertussis
hsa05130  Pathogenic Escherichia coli infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05210  Colorectal cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05200  Pathways in cancer
hsa04360  Axon guidance
hsa04722  Neurotrophin signaling pathway
hsa04972  Pancreatic secretion
hsa04270  Vascular smooth muscle contraction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04921  Oxytocin signaling pathway
hsa04062  Chemokine signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04660  T cell receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04530  Tight junction
hsa04520  Adherens junction
hsa04510  Focal adhesion
hsa04144  Endocytosis
hsa04150  mTOR signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04310  Wnt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway

Diseases

Associated diseases	References
Crohn's disease	GAD20307617
Endometriosis	PubMed21303778

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21303778	Endometrio sis			30(16 patients with endometrio sis, 14 endomet riosis free con trols)			Show abstract
17204524	Endometrio sis						Show abstract