Endometriosis Knowledgebase

Search Result

Gene id

387332

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TBPL2 Gene UCSC Ensembl

Aliases

TBP2, TRF3

Gene name

TATA-box binding protein like 2

Alternate names

TATA box-binding protein-like protein 2, TATA box-binding protein-related factor 3, TBP-like protein 2, TBP-related factor 3,

Gene location

14q22.3 (55440544: 55414209) Exons: 7 NC_000014.9

OMIM

608964

Protein Summary

Protein general information

Q6SJ96

Name: TATA box binding protein like protein 2 (TBP like protein 2) (TATA box binding protein related factor 3) (TBP related factor 3)

Length: 375 Mass: 41,524

Tissue specificity: Ubiquitously expressed in all tissues examined with highest levels in heart, lung, ovary, spleen and testes. {ECO

Sequence

MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPLFSPVVPYDMYILNAS
NPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQDVGLGLNSSS
LSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAK
NAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCD
VRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKA

Structural information

Interpro:	IPR000814 IPR030491 IPR033710
Prosite:	PS00351
Pfam:	PF00352
CDD:	cd04516
STRING:	ENSP00000247219;

Other Databases

GeneCards: TBPL2; Malacards: TBPL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006352	DNA-templated transcripti on, initiation	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006352	DNA-templated transcripti on, initiation	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component

KEGG pathways

hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
hsa05016  Huntington's disease
hsa03022  Basal transcription factors

Diseases

Associated diseases	References
Endometriosis	PMID: 20172870
Endometriosis	INFBASE20172870

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20172870	Endometrio sis			66 (35 patients with histologi cally confirmed endometriosis, 31 patients wi thout endometri osis)		TRX TBP-2	Show abstract
25376627	Endometrio sis			65 (31 patients with endometri osis, 34 patien ts without endo metriosis)	Female infertility	GPX3 IL6 IL8 TNF TXN TBPL2	Show abstract