Endometriosis Knowledgebase

Search Result

Gene id

3880

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KRT19 Gene UCSC Ensembl

Aliases

CK19, K19, K1CS

Gene name

keratin 19

Alternate names

keratin, type I cytoskeletal 19, 40-kDa keratin intermediate filament, CK-19, cytokeratin 19, keratin 19, type I, keratin, type I, 40-kd,

Gene location

17q21.2 (41528388: 41523616) Exons: 6 NC_000017.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. [provided by RefSeq, Jul 2008]

Protein Summary

Protein general information

P08727

Name: Keratin, type I cytoskeletal 19 (Cytokeratin-19) (CK-19) (Keratin-19) (K19)

Length: 400 Mass: 44,106

Tissue specificity: Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral

Sequence

MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGAYGGGYGGVLTASDGL
LAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSR
IVLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTL
RGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQ
EIATYRSLLEGQEDHYNNLSASKVL

Structural information

Protein Domains	IF (80-391)
Interpro:	IPR001664 IPR018039 IPR002957
Prosite:	PS00226 PS51842
Pfam:	PF00038
DIP:	35655
MINT:
STRING:	ENSP00000355124;

Other Databases

GeneCards: KRT19; Malacards: KRT19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005200	structural constituent of cytoskeleton	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005882	intermediate filament	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0008307	structural constituent of muscle	IDA	molecular_function
GO:0016010	dystrophin-associated gly coprotein complex	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0030018	Z disc	IEA	cellular_component
GO:0032403	protein complex binding	IEA	molecular_function
GO:0042383	sarcolemma	IEA	cellular_component
GO:0043034	costamere	IDA	cellular_component
GO:0043627	response to estrogen	IEP	biological_process
GO:0045214	sarcomere organization	IDA	biological_process
GO:0060706	cell differentiation invo lved in embryonic placent a development	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071944	cell periphery	IDA	cellular_component
GO:1990357	terminal web	IEA	cellular_component
GO:0005198	structural molecule activ ity	IEA	molecular_function
GO:0005200	structural constituent of cytoskeleton	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005882	intermediate filament	IEA	cellular_component
GO:0005882	intermediate filament	IEA	cellular_component
GO:0005882	intermediate filament	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0008307	structural constituent of muscle	IDA	molecular_function
GO:0016010	dystrophin-associated gly coprotein complex	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0030018	Z disc	IEA	cellular_component
GO:0032403	protein complex binding	IEA	molecular_function
GO:0042383	sarcolemma	IEA	cellular_component
GO:0043034	costamere	IDA	cellular_component
GO:0043627	response to estrogen	IEP	biological_process
GO:0045214	sarcomere organization	IDA	biological_process
GO:0060706	cell differentiation invo lved in embryonic placent a development	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071944	cell periphery	IDA	cellular_component
GO:1990357	terminal web	IEA	cellular_component
GO:0005200	structural constituent of cytoskeleton	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005882	intermediate filament	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0008307	structural constituent of muscle	IDA	molecular_function
GO:0043034	costamere	IDA	cellular_component
GO:0043627	response to estrogen	IEP	biological_process
GO:0045214	sarcomere organization	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071944	cell periphery	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 21168580
Endometriosis	INFBASE21168580

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21168580	Endometrio sis					Cytokeratin-19	Show abstract