Endometriosis Knowledgebase

Search Result

Gene id

389

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RHOC Gene UCSC Ensembl

Aliases

ARH9, ARHC, H9, RHOH9

Gene name

ras homolog family member C

Alternate names

rho-related GTP-binding protein RhoC, RAS-related homolog 9, oncogene RHO H9, ras homolog gene family, member C, rho cDNA clone 9, rhoC GTPase, small GTP binding protein RhoC,

Gene location

1p13.2 (112707402: 112701126) Exons: 7 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

OMIM

165380

Protein Summary

Protein general information

P08134

Name: Rho related GTP binding protein RhoC (Rho cDNA clone 9) (h9)

Length: 193 Mass: 22,006

Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYP
DTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANR
ISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

Structural information

Motifs	Effector region.(34-42)
Interpro:	IPR027417 IPR005225 IPR001806 IPR003578
Prosite:	PS51420
Pfam:	PF00071
PDB:	1Z2C 2GCN 2GCO 2GCP
PDBsum:	1Z2C 2GCN 2GCO 2GCP
MINT:	1216716
STRING:	ENSP00000285735;

Other Databases

GeneCards: RHOC; Malacards: RHOC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000910	cytokinesis	IDA	biological_process
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0032154	cleavage furrow	IDA	cellular_component
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043297	apical junction assembly	IDA	biological_process
GO:0044319	wound healing, spreading of cells	ISS	biological_process
GO:0051056	regulation of small GTPas e mediated signal transdu ction	TAS	biological_process
GO:0060193	positive regulation of li pase activity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902766	skeletal muscle satellite cell migration	ISS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000910	cytokinesis	IDA	biological_process
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0032154	cleavage furrow	IEA	cellular_component
GO:0032154	cleavage furrow	IDA	cellular_component
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043297	apical junction assembly	IEA	biological_process
GO:0043297	apical junction assembly	IDA	biological_process
GO:0044319	wound healing, spreading of cells	ISS	biological_process
GO:0051056	regulation of small GTPas e mediated signal transdu ction	TAS	biological_process
GO:0060193	positive regulation of li pase activity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902766	skeletal muscle satellite cell migration	ISS	biological_process
GO:0000910	cytokinesis	IDA	biological_process
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0032154	cleavage furrow	IDA	cellular_component
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043297	apical junction assembly	IDA	biological_process
GO:0044319	wound healing, spreading of cells	ISS	biological_process
GO:0051056	regulation of small GTPas e mediated signal transdu ction	TAS	biological_process
GO:0060193	positive regulation of li pase activity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902766	skeletal muscle satellite cell migration	ISS	biological_process

Diseases

Associated diseases	References
Cancer	PMID: 19094228
Coronary spastic angina	PMID: 19911011
Endometriosis	PMID: 23302395
Endometriosis	INFBASE23302395

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23302395	Endometrio sis			55 (40 patients diagnosed with endometriosis( ), 15 healthy f ertile women)			Show abstract