Endometriosis Knowledgebase

Search Result

Gene id

390

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RND3 Gene UCSC Ensembl

Aliases

ARHE, Rho8, RhoE, memB

Gene name

Rho family GTPase 3

Alternate names

rho-related GTP-binding protein RhoE, protein MemB, ras homolog gene family, member E, rho-related GTP-binding protein Rho8, small GTP binding protein Rho8,

Gene location

2q23.3 (150487694: 150468192) Exons: 6 NC_000002.12

Gene summary(Entrez)

This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]

OMIM

602924

Protein Summary

Protein general information

P61587

Name: Rho related GTP binding protein RhoE (Protein MemB) (Rho family GTPase 3) (Rho related GTP binding protein Rho8) (Rnd3)

Length: 244 Mass: 27,368

Tissue specificity: Ubiquitous.

Sequence

MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSL
WDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELS
NHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPE
LSAVATDLRKDKAKSCTVM

Structural information

Motifs	Effector region.(52-60)
Interpro:	IPR027417 IPR005225 IPR001806 IPR003578
Prosite:	PS51420
Pfam:	PF00071
PDB:	1M7B 2V55 4BG6
PDBsum:	1M7B 2V55 4BG6
MINT:	3974781
STRING:	ENSP00000263895;

Other Databases

GeneCards: RND3; Malacards: RND3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0003924	GTPase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	TAS	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0003924	GTPase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	TAS	molecular_function
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	TAS	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0003924	GTPase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	TAS	molecular_function
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	TAS	biological_process
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Blood pressure	PMID: 17903302
Diabetes	PMID: 22238593
Endometriosis	PMID: 23472165
Endometriosis	INFBASE23472165
Endometriosis	INFBASE16249290
Respiration disorders	PMID: 17903308

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16249290	Endometrio sis			30 (15 patients undergoing lap aroscopy or hys terectomy for e ndometriosis, 1 5 controls)		IGFBP5 PIM2 RPL41 PSAP FBLN1 SIPL DLX5 HSD11B2 SET and RHOE	Show abstract
23472165	Endometrio sis	LINC00339-WNT4 (rs2235529), RND3-RBM43 (rs1519761, rs6757804)	Europea n	16490 (2,019 su rgically confir med endometrios is cases, 14,47 1 controls)	Female infertility	LINC00339-WNT4 RND3-RBM43	Show abstract