Endometriosis Knowledgebase

Search Result

Gene id

3925

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

STMN1 Gene UCSC Ensembl

Aliases

C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN

Gene name

stathmin 1

Alternate names

stathmin, leukemia-associated phosphoprotein p18, metablastin, oncoprotein 18, phosphoprotein 19, phosphoprotein p19, prosolin, stathmin 1/oncoprotein 18, testicular tissue protein Li 189, transmembrane protein C1orf215,

Gene location

1p36.11 (25906876: 25884185) Exons: 8 NC_000001.11

Gene summary(Entrez)

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]

OMIM

151442

Protein Summary

Protein general information

P16949

Name: Stathmin (Leukemia associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)

Length: 149 Mass: 17,303

Tissue specificity: Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is read

Sequence

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEK
REHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Structural information

Protein Domains	SLD. (4-145)
Interpro:	IPR030514 IPR000956
Prosite:	PS00563 PS01041 PS51663
Pfam:	PF00836
MINT:	2860454
STRING:	ENSP00000410452;

Other Databases

GeneCards: MIR3917;STMN1; Malacards: MIR3917

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000281	mitotic cytokinesis	IMP	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005874	microtubule	IEA	cellular_component
GO:0007019	microtubule depolymerizat ion	IDA	biological_process
GO:0007052	mitotic spindle organizat ion	IDA	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0015631	tubulin binding	IDA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0031115	negative regulation of mi crotubule polymerization	IEA	biological_process
GO:0031175	neuron projection develop ment	IBA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0043005	neuron projection	IBA	cellular_component
GO:0051272	positive regulation of ce llular component movement	IEA	biological_process
GO:0051493	regulation of cytoskeleto n organization	IBA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000281	mitotic cytokinesis	IMP	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005874	microtubule	IEA	cellular_component
GO:0007019	microtubule depolymerizat ion	IDA	biological_process
GO:0007052	mitotic spindle organizat ion	IDA	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0015631	tubulin binding	IDA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0030154	cell differentiation	IEA	biological_process
GO:0031110	regulation of microtubule polymerization or depoly merization	IEA	biological_process
GO:0031115	negative regulation of mi crotubule polymerization	IEA	biological_process
GO:0031175	neuron projection develop ment	IBA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0043005	neuron projection	IBA	cellular_component
GO:0051272	positive regulation of ce llular component movement	IEA	biological_process
GO:0051493	regulation of cytoskeleto n organization	IBA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000281	mitotic cytokinesis	IMP	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0007019	microtubule depolymerizat ion	IDA	biological_process
GO:0007052	mitotic spindle organizat ion	IDA	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0015631	tubulin binding	IDA	molecular_function
GO:0031175	neuron projection develop ment	IBA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0043005	neuron projection	IBA	cellular_component
GO:0051493	regulation of cytoskeleto n organization	IBA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa05206 MicroRNAs in cancer
hsa04010 MAPK signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 20819663
Endometriosis	INFBASE20819663
Multiple sclerosis	PMID: 19012073

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20819663	Endometrio sis					Stathmin	Show abstract