Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3952
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol LEP   Gene   UCSC   Ensembl
Aliases LEPD, OB, OBS
Gene name leptin
Alternate names leptin, leptin (murine obesity homolog), leptin (obesity homolog, mouse), obese protein, obese, mouse, homolog of, obesity factor,
Gene location 7q32.1 (128241200: 128257628)     Exons: 3     NC_000007.14
Gene summary(Entrez) This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Jul 2008]
OMIM 164160

Protein Summary

Protein general information P41159  

Name: Leptin (Obese protein) (Obesity factor)

Length: 167  Mass: 18,641

Tissue specificity: Adipose tissue is the main source of leptin it is also produced by other peripheral tissues such as the skeletal muscle (PubMed

Sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKM
DQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRL
QGSLQDMLWQLDLSPGC
Structural information
Interpro:  IPR009079 IPR000065

Pfam:  
PF02024

PDB:  
1AX8
PDBsum:   1AX8

DIP:  
6116
STRING:   ENSP00000312652;
Other Databases GeneCards:  LEP;  Malacards:  LEP

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0001525 angiogenesis
IDA biological_process
GO:0001525 angiogenesis
IDA biological_process
GO:0001542 ovulation from ovarian fo
llicle
IEA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0001819 positive regulation of cy
tokine production
IEA biological_process
GO:0001890 placenta development
IDA biological_process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological_process
GO:0002021 response to dietary exces
s
IEA biological_process
GO:0003300 cardiac muscle hypertroph
y
IEA biological_process
GO:0005179 hormone activity
IBA molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
ISS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0006006 glucose metabolic process
IEA biological_process
GO:0006111 regulation of gluconeogen
esis
IEA biological_process
GO:0006112 energy reserve metabolic
process
IEA biological_process
GO:0006114 glycerol biosynthetic pro
cess
IEA biological_process
GO:0006629 lipid metabolic process
IBA biological_process
GO:0006635 fatty acid beta-oxidation
IEA biological_process
GO:0007260 tyrosine phosphorylation
of STAT protein
IBA biological_process
GO:0007565 female pregnancy
IEA biological_process
GO:0007623 circadian rhythm
IEA biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008203 cholesterol metabolic pro
cess
IEA biological_process
GO:0008206 bile acid metabolic proce
ss
IEA biological_process
GO:0008217 regulation of blood press
ure
IEA biological_process
GO:0008343 adult feeding behavior
ISS biological_process
GO:0010507 negative regulation of au
tophagy
IDA biological_process
GO:0010888 negative regulation of li
pid storage
IEA biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IDA biological_process
GO:0014823 response to activity
IEA biological_process
GO:0019953 sexual reproduction
IMP biological_process
GO:0021954 central nervous system ne
uron development
IEA biological_process
GO:0030073 insulin secretion
IEA biological_process
GO:0030217 T cell differentiation
ISS biological_process
GO:0030300 regulation of intestinal
cholesterol absorption
IEA biological_process
GO:0032008 positive regulation of TO
R signaling
IDA biological_process
GO:0032099 negative regulation of ap
petite
ISS biological_process
GO:0032310 prostaglandin secretion
IDA biological_process
GO:0032355 response to estradiol
IEA biological_process
GO:0032814 regulation of natural kil
ler cell activation
IDA biological_process
GO:0032817 regulation of natural kil
ler cell proliferation
IDA biological_process
GO:0032868 response to insulin
IBA biological_process
GO:0033197 response to vitamin E
IEA biological_process
GO:0033210 leptin-mediated signaling
pathway
ISS biological_process
GO:0033210 leptin-mediated signaling
pathway
ISS biological_process
GO:0033686 positive regulation of lu
teinizing hormone secreti
on
IEA biological_process
GO:0035360 positive regulation of pe
roxisome proliferator act
ivated receptor signaling
pathway
IEA biological_process
GO:0035630 bone mineralization invol
ved in bone maturation
IEA biological_process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
ISS biological_process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
IBA biological_process
GO:0042102 positive regulation of T
cell proliferation
IDA biological_process
GO:0042269 regulation of natural kil
ler cell mediated cytotox
icity
IDA biological_process
GO:0042445 hormone metabolic process
IEA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IEA biological_process
GO:0042593 glucose homeostasis
IEA biological_process
GO:0042755 eating behavior
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0043270 positive regulation of io
n transport
IEA biological_process
GO:0043410 positive regulation of MA
PK cascade
ISS biological_process
GO:0043410 positive regulation of MA
PK cascade
IDA biological_process
GO:0044320 cellular response to lept
in stimulus
IDA biological_process
GO:0045471 response to ethanol
IEA biological_process
GO:0045639 positive regulation of my
eloid cell differentiatio
n
IEA biological_process
GO:0045765 regulation of angiogenesi
s
IDA biological_process
GO:0045906 negative regulation of va
soconstriction
IEA biological_process
GO:0046325 negative regulation of gl
ucose import
IDA biological_process
GO:0046427 positive regulation of JA
K-STAT cascade
IDA biological_process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
IEA biological_process
GO:0046850 regulation of bone remode
ling
ISS biological_process
GO:0046881 positive regulation of fo
llicle-stimulating hormon
e secretion
IEA biological_process
GO:0048639 positive regulation of de
velopmental growth
IDA biological_process
GO:0050796 regulation of insulin sec
retion
IEA biological_process
GO:0050810 regulation of steroid bio
synthetic process
IEA biological_process
GO:0050892 intestinal absorption
IDA biological_process
GO:0050901 leukocyte tethering or ro
lling
IEA biological_process
GO:0050999 regulation of nitric-oxid
e synthase activity
IDA biological_process
GO:0051428 peptide hormone receptor
binding
IBA molecular_function
GO:0051726 regulation of cell cycle
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
ISS biological_process
GO:0060587 regulation of lipoprotein
lipid oxidation
IEA biological_process
GO:0060612 adipose tissue developmen
t
IEA biological_process
GO:0061037 negative regulation of ca
rtilage development
IEA biological_process
GO:0070093 negative regulation of gl
ucagon secretion
IEA biological_process
GO:0071298 cellular response to L-as
corbic acid
IEA biological_process
GO:0071300 cellular response to reti
noic acid
IEA biological_process
GO:0072604 interleukin-6 secretion
IDA biological_process
GO:0072606 interleukin-8 secretion
IDA biological_process
GO:0090335 regulation of brown fat c
ell differentiation
ISS biological_process
GO:0098868 bone growth
ISS biological_process
GO:1900015 regulation of cytokine pr
oduction involved in infl
ammatory response
IDA biological_process
GO:1900745 positive regulation of p3
8MAPK cascade
IDA biological_process
GO:1904651 positive regulation of fa
t cell apoptotic process
IEA biological_process
GO:1990051 activation of protein kin
ase C activity
IDA biological_process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IBA biological_process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IEA biological_process
GO:2000486 negative regulation of gl
utamine transport
IEA biological_process
GO:2000491 positive regulation of he
patic stellate cell activ
ation
IEA biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0001525 angiogenesis
IDA biological_process
GO:0001525 angiogenesis
IDA biological_process
GO:0001542 ovulation from ovarian fo
llicle
IEA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0001819 positive regulation of cy
tokine production
IEA biological_process
GO:0001890 placenta development
IDA biological_process
GO:0001932 regulation of protein pho
sphorylation
IEA biological_process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological_process
GO:0002021 response to dietary exces
s
IEA biological_process
GO:0003300 cardiac muscle hypertroph
y
IEA biological_process
GO:0005102 receptor binding
IEA molecular_function
GO:0005179 hormone activity
IEA molecular_function
GO:0005179 hormone activity
IEA molecular_function
GO:0005179 hormone activity
IBA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
ISS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0006006 glucose metabolic process
IEA biological_process
GO:0006111 regulation of gluconeogen
esis
IEA biological_process
GO:0006112 energy reserve metabolic
process
IEA biological_process
GO:0006112 energy reserve metabolic
process
TAS biological_process
GO:0006114 glycerol biosynthetic pro
cess
IEA biological_process
GO:0006629 lipid metabolic process
IEA biological_process
GO:0006629 lipid metabolic process
IBA biological_process
GO:0006635 fatty acid beta-oxidation
IEA biological_process
GO:0007165 signal transduction
IEA biological_process
GO:0007260 tyrosine phosphorylation
of STAT protein
IEA biological_process
GO:0007260 tyrosine phosphorylation
of STAT protein
IBA biological_process
GO:0007565 female pregnancy
IEA biological_process
GO:0007584 response to nutrient
IEA biological_process
GO:0007623 circadian rhythm
IEA biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008203 cholesterol metabolic pro
cess
IEA biological_process
GO:0008206 bile acid metabolic proce
ss
IEA biological_process
GO:0008217 regulation of blood press
ure
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008343 adult feeding behavior
IEA biological_process
GO:0008343 adult feeding behavior
ISS biological_process
GO:0009062 fatty acid catabolic proc
ess
IEA biological_process
GO:0009892 negative regulation of me
tabolic process
IEA biological_process
GO:0010507 negative regulation of au
tophagy
IEA biological_process
GO:0010507 negative regulation of au
tophagy
IDA biological_process
GO:0010888 negative regulation of li
pid storage
IEA biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IEA biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IDA biological_process
GO:0014823 response to activity
IEA biological_process
GO:0019222 regulation of metabolic p
rocess
IEA biological_process
GO:0019953 sexual reproduction
IEA biological_process
GO:0019953 sexual reproduction
IMP biological_process
GO:0021954 central nervous system ne
uron development
IEA biological_process
GO:0030073 insulin secretion
IEA biological_process
GO:0030217 T cell differentiation
IEA biological_process
GO:0030217 T cell differentiation
ISS biological_process
GO:0030300 regulation of intestinal
cholesterol absorption
IEA biological_process
GO:0031667 response to nutrient leve
ls
IEA biological_process
GO:0032008 positive regulation of TO
R signaling
IDA biological_process
GO:0032099 negative regulation of ap
petite
IEA biological_process
GO:0032099 negative regulation of ap
petite
ISS biological_process
GO:0032310 prostaglandin secretion
IDA biological_process
GO:0032355 response to estradiol
IEA biological_process
GO:0032814 regulation of natural kil
ler cell activation
IDA biological_process
GO:0032817 regulation of natural kil
ler cell proliferation
IDA biological_process
GO:0032868 response to insulin
IEA biological_process
GO:0032868 response to insulin
IBA biological_process
GO:0033197 response to vitamin E
IEA biological_process
GO:0033210 leptin-mediated signaling
pathway
IEA biological_process
GO:0033210 leptin-mediated signaling
pathway
ISS biological_process
GO:0033210 leptin-mediated signaling
pathway
ISS biological_process
GO:0033686 positive regulation of lu
teinizing hormone secreti
on
IEA biological_process
GO:0035360 positive regulation of pe
roxisome proliferator act
ivated receptor signaling
pathway
IEA biological_process
GO:0035556 intracellular signal tran
sduction
IEA biological_process
GO:0035630 bone mineralization invol
ved in bone maturation
IEA biological_process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
ISS biological_process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
IBA biological_process
GO:0042102 positive regulation of T
cell proliferation
IDA biological_process
GO:0042269 regulation of natural kil
ler cell mediated cytotox
icity
IDA biological_process
GO:0042307 positive regulation of pr
otein import into nucleus
IEA biological_process
GO:0042445 hormone metabolic process
IEA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IEA biological_process
GO:0042593 glucose homeostasis
IEA biological_process
GO:0042755 eating behavior
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0043270 positive regulation of io
n transport
IEA biological_process
GO:0043410 positive regulation of MA
PK cascade
IEA biological_process
GO:0043410 positive regulation of MA
PK cascade
ISS biological_process
GO:0043410 positive regulation of MA
PK cascade
IDA biological_process
GO:0044320 cellular response to lept
in stimulus
IDA biological_process
GO:0045471 response to ethanol
IEA biological_process
GO:0045598 regulation of fat cell di
fferentiation
IEA biological_process
GO:0045639 positive regulation of my
eloid cell differentiatio
n
IEA biological_process
GO:0045765 regulation of angiogenesi
s
IDA biological_process
GO:0045906 negative regulation of va
soconstriction
IEA biological_process
GO:0046325 negative regulation of gl
ucose import
IDA biological_process
GO:0046427 positive regulation of JA
K-STAT cascade
IEA biological_process
GO:0046427 positive regulation of JA
K-STAT cascade
IDA biological_process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
IEA biological_process
GO:0046850 regulation of bone remode
ling
IEA biological_process
GO:0046850 regulation of bone remode
ling
ISS biological_process
GO:0046881 positive regulation of fo
llicle-stimulating hormon
e secretion
IEA biological_process
GO:0048639 positive regulation of de
velopmental growth
IDA biological_process
GO:0050796 regulation of insulin sec
retion
IEA biological_process
GO:0050810 regulation of steroid bio
synthetic process
IEA biological_process
GO:0050892 intestinal absorption
IDA biological_process
GO:0050901 leukocyte tethering or ro
lling
IEA biological_process
GO:0050999 regulation of nitric-oxid
e synthase activity
IEA biological_process
GO:0050999 regulation of nitric-oxid
e synthase activity
IDA biological_process
GO:0051428 peptide hormone receptor
binding
IEA molecular_function
GO:0051428 peptide hormone receptor
binding
IBA molecular_function
GO:0051726 regulation of cell cycle
IEA biological_process
GO:0051726 regulation of cell cycle
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IEA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
ISS biological_process
GO:0060587 regulation of lipoprotein
lipid oxidation
IEA biological_process
GO:0060612 adipose tissue developmen
t
IEA biological_process
GO:0061037 negative regulation of ca
rtilage development
IEA biological_process
GO:0070093 negative regulation of gl
ucagon secretion
IEA biological_process
GO:0071298 cellular response to L-as
corbic acid
IEA biological_process
GO:0071300 cellular response to reti
noic acid
IEA biological_process
GO:0072604 interleukin-6 secretion
IDA biological_process
GO:0072606 interleukin-8 secretion
IDA biological_process
GO:0090335 regulation of brown fat c
ell differentiation
IEA biological_process
GO:0090335 regulation of brown fat c
ell differentiation
ISS biological_process
GO:0098868 bone growth
IEA biological_process
GO:0098868 bone growth
ISS biological_process
GO:1900015 regulation of cytokine pr
oduction involved in infl
ammatory response
IDA biological_process
GO:1900180 regulation of protein loc
alization to nucleus
IEA biological_process
GO:1900745 positive regulation of p3
8MAPK cascade
IDA biological_process
GO:1904651 positive regulation of fa
t cell apoptotic process
IEA biological_process
GO:1990051 activation of protein kin
ase C activity
IDA biological_process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IEA biological_process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IBA biological_process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IEA biological_process
GO:2000486 negative regulation of gl
utamine transport
IEA biological_process
GO:2000491 positive regulation of he
patic stellate cell activ
ation
IEA biological_process
GO:0001525 angiogenesis
IDA biological_process
GO:0001525 angiogenesis
IDA biological_process
GO:0001890 placenta development
IDA biological_process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological_process
GO:0005179 hormone activity
IBA molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
ISS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006112 energy reserve metabolic
process
TAS biological_process
GO:0006629 lipid metabolic process
IBA biological_process
GO:0007260 tyrosine phosphorylation
of STAT protein
IBA biological_process
GO:0008343 adult feeding behavior
ISS biological_process
GO:0010507 negative regulation of au
tophagy
IDA biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IDA biological_process
GO:0019953 sexual reproduction
IMP biological_process
GO:0030217 T cell differentiation
ISS biological_process
GO:0032008 positive regulation of TO
R signaling
IDA biological_process
GO:0032099 negative regulation of ap
petite
ISS biological_process
GO:0032310 prostaglandin secretion
IDA biological_process
GO:0032814 regulation of natural kil
ler cell activation
IDA biological_process
GO:0032817 regulation of natural kil
ler cell proliferation
IDA biological_process
GO:0032868 response to insulin
IBA biological_process
GO:0033210 leptin-mediated signaling
pathway
ISS biological_process
GO:0033210 leptin-mediated signaling
pathway
ISS biological_process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
ISS biological_process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
IBA biological_process
GO:0042102 positive regulation of T
cell proliferation
IDA biological_process
GO:0042269 regulation of natural kil
ler cell mediated cytotox
icity
IDA biological_process
GO:0043410 positive regulation of MA
PK cascade
ISS biological_process
GO:0043410 positive regulation of MA
PK cascade
IDA biological_process
GO:0044320 cellular response to lept
in stimulus
IDA biological_process
GO:0045765 regulation of angiogenesi
s
IDA biological_process
GO:0046325 negative regulation of gl
ucose import
IDA biological_process
GO:0046427 positive regulation of JA
K-STAT cascade
IDA biological_process
GO:0046850 regulation of bone remode
ling
ISS biological_process
GO:0048639 positive regulation of de
velopmental growth
IDA biological_process
GO:0050892 intestinal absorption
IDA biological_process
GO:0050999 regulation of nitric-oxid
e synthase activity
IDA biological_process
GO:0051428 peptide hormone receptor
binding
IBA molecular_function
GO:0051726 regulation of cell cycle
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
ISS biological_process
GO:0072604 interleukin-6 secretion
IDA biological_process
GO:0072606 interleukin-8 secretion
IDA biological_process
GO:0090335 regulation of brown fat c
ell differentiation
ISS biological_process
GO:0098868 bone growth
ISS biological_process
GO:1900015 regulation of cytokine pr
oduction involved in infl
ammatory response
IDA biological_process
GO:1900745 positive regulation of p3
8MAPK cascade
IDA biological_process
GO:1990051 activation of protein kin
ase C activity
IDA biological_process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IBA biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04932  Non-alcoholic fatty liver disease
hsa04152  AMPK signaling pathway
hsa04920  Adipocytokine signaling pathway

Diseases

Associated diseases References
Amenorrhea PMID: 22252944
Amyotrophic lateral sclerosis (ALS) PMID: 18608101
Asthma PMID: 19191138
Attention-deficit hyperactivity disorder (ADHD) PMID: 11140838
Autism PMID: 19058789
Azoospermia PMID: 21735645
Behcet's disease PMID: 16786343
Cancer PMID: 12712467
Chronic obstructive pulmonary disease (COPD) PMID: 19625176
Defective endometrial receptivity PMID: 25935494
Depression PMID: 19382181
Diabetes PMID: 18955751
Endometrial receptivity PMID: 15142989
Endometriosis PMID: 20825374
Female infertility PMID: 15588162
Hypergonadotropic hypogonadism PMID: 12950408
Hypogonadotropic hypogonadism PMID: 22343341
Hypothalamic amenorrhea PMID: 12151434
Idiopathic asthenozoospermia PMID: 25419396
Leucocytospermia PMID: 25081128
Male infertility PMID: 17209884
Metabolic syndrome PMID: 15978856
Multiple sclerosis PMID: 19604093
Obesity PMID: 12187394
Oligozoospermia PMID: 17714215
Ovarian endometriosis PMID: 25797583
Ovarian hyperstimulation syndrome(OHSS) PMID: 15374699
Pelvic endometriosis PMID: 20504092
Polycystic ovary syndrome (PCOS) PMID: 26051098
Ovarian endometriosis INFBASE25797583
Endometriosis (ovarian) INFBASE25797583
Endometriosis associated infertility INFBASE20504092
Endometriosis (Pelvic) INFBASE20504092
Ovarian�endometriosis INFBASE19544117
Endometriosis associated infertility INFBASE18958774
Idiopathic infertility INFBASE16269446
Female infertility INFBASE16190409
Endometriosis INFBASE12773447
Preeclampsia PMID: 18958929
Premature ovarian failure ( POF) PMID: 19609224
Primary infertility PMID: 18665375
Psychiatric disorders PMID: 19086053
Recurrent miscarriage PMID: 26952510
Schizophrenia PMID: 14720418
Sertoli cell-only syndrome (SCOS) PMID: 17212806
Unexplained recurrent pregnancy loss (RPL) PMID: 22265003
Varicocele PMID: 25081128

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17706208 Endometrio
sis

141 (63 women w
ith surgically
confirmed stage
II-IV endometr
iosis, 78 women
who were surgi
cally confirmed
to be free of
endometriosis)
MIF
MCP-1
INFG
LEP
CA-127
Show abstract
26242176 Endometrio
sis

25 (15 patients
who underwent
surgery for adn
exal masses and
infertility, 1
0 controls who
underwent surge
ry for tubal li
gation)
Female infertility
Show abstract
21848410 Endometrio
sis

86 (58 women wi
th endometriosi
s and 28 women
undergoing tuba
l ligation)
Leptin
IL-8
Show abstract
19230876 Endometrio
sis


MCP-1
MIF
LEP
and CA-125
Show abstract
12773447 Endometrio
sis

78 (60 women un
dergoing laparo
scopy for endom
etriosis, 18 co
ntrols undergoi
ng tubal steril
ization)

Show abstract
16269446 Endometrio
sis

108 (60 patient
s were diagnose
d with endometr
iosis, 10 with
idiopathic infe
rtility, 38 had
undergone tuba
l ligation or r
eanastomosis (c
ontrol group))
Female infertility LEP
Show abstract
18958774 Endometrio
sis

56 patients bei
ng diagnosed fo
r infertility a
nd/or pelvic pa
in
Female infertility
Show abstract
16190409 Endometrio
sis


Female infertility LEP
Show abstract
20504092 Endometrio
sis (Pelvi
c)

50 (15 had endo
metriosis (case
s), 35 had no e
ndometriosis (c
ontrols))

Show abstract
19544117 Endometrio
sis (ovari
an)

37 (11 women wi
th 'superficial
' endometriomas
located at the
ovarian surfac
e, 16 patients
with 'deep' int
ra-ovarian endo
metriomas, 10 w
omen undergoing
laparoscopy fo
r unexplained i
nfertility and
not affected by
pelvic and/or
ovarian endomet
riosis were con

Show abstract
15465848 Endometrio
sis

42 (30 patients
with severe/mo
derate endometr
iosis, 12 ferti
le controls)
LEP
LEPR
Show abstract
20047585 Endometrio
sis

60 (40 patients
with endometri
osis, 20 patien
ts did not have
endometriosis)
COX-2
Leptin
Show abstract
25797583 Endometrio
sis (ovari
an)

98 (58 women wi
th ovarian endo
metriosis (case
s), 40 healthy
women undergoin
g sterilization
or patients wi
th benign ovari
an cysts (contr
ols))
Female infertility IL6
IL8
PAEP
LEP
Show abstract
20825374 Endometrio
sis

28 infertile wo
men with endome
triosis (study
group), 23 wome
n with fallopia
n-associated in
fertility (cont
rols), and 24 w
omen with myoma
(controls)
Female infertility Leptin
MCP-1
andTNF-alpha levels
Show abstract