Endometriosis Knowledgebase

Search Result

Gene id

3952

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LEP Gene UCSC Ensembl

Aliases

LEPD, OB, OBS

Gene name

leptin

Alternate names

leptin, leptin (murine obesity homolog), leptin (obesity homolog, mouse), obese protein, obese, mouse, homolog of, obesity factor,

Gene location

7q32.1 (128241200: 128257628) Exons: 3 NC_000007.14

Gene summary(Entrez)

This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Jul 2008]

OMIM

164160

Protein Summary

Protein general information

P41159

Name: Leptin (Obese protein) (Obesity factor)

Length: 167 Mass: 18,641

Tissue specificity: Adipose tissue is the main source of leptin it is also produced by other peripheral tissues such as the skeletal muscle (PubMed

Sequence

MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKM
DQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRL
QGSLQDMLWQLDLSPGC

Structural information

Interpro:	IPR009079 IPR000065
Pfam:	PF02024
PDB:	1AX8
PDBsum:	1AX8
DIP:	6116
STRING:	ENSP00000312652;

Other Databases

GeneCards: LEP; Malacards: LEP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001542	ovulation from ovarian fo llicle	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001819	positive regulation of cy tokine production	IEA	biological_process
GO:0001890	placenta development	IDA	biological_process
GO:0001936	regulation of endothelial cell proliferation	IDA	biological_process
GO:0002021	response to dietary exces s	IEA	biological_process
GO:0003300	cardiac muscle hypertroph y	IEA	biological_process
GO:0005179	hormone activity	IBA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0006111	regulation of gluconeogen esis	IEA	biological_process
GO:0006112	energy reserve metabolic process	IEA	biological_process
GO:0006114	glycerol biosynthetic pro cess	IEA	biological_process
GO:0006629	lipid metabolic process	IBA	biological_process
GO:0006635	fatty acid beta-oxidation	IEA	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IBA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0008206	bile acid metabolic proce ss	IEA	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008343	adult feeding behavior	ISS	biological_process
GO:0010507	negative regulation of au tophagy	IDA	biological_process
GO:0010888	negative regulation of li pid storage	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0019953	sexual reproduction	IMP	biological_process
GO:0021954	central nervous system ne uron development	IEA	biological_process
GO:0030073	insulin secretion	IEA	biological_process
GO:0030217	T cell differentiation	ISS	biological_process
GO:0030300	regulation of intestinal cholesterol absorption	IEA	biological_process
GO:0032008	positive regulation of TO R signaling	IDA	biological_process
GO:0032099	negative regulation of ap petite	ISS	biological_process
GO:0032310	prostaglandin secretion	IDA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032814	regulation of natural kil ler cell activation	IDA	biological_process
GO:0032817	regulation of natural kil ler cell proliferation	IDA	biological_process
GO:0032868	response to insulin	IBA	biological_process
GO:0033197	response to vitamin E	IEA	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033686	positive regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035360	positive regulation of pe roxisome proliferator act ivated receptor signaling pathway	IEA	biological_process
GO:0035630	bone mineralization invol ved in bone maturation	IEA	biological_process
GO:0038108	negative regulation of ap petite by leptin-mediated signaling pathway	ISS	biological_process
GO:0038108	negative regulation of ap petite by leptin-mediated signaling pathway	IBA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042269	regulation of natural kil ler cell mediated cytotox icity	IDA	biological_process
GO:0042445	hormone metabolic process	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042755	eating behavior	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043270	positive regulation of io n transport	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	ISS	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0044320	cellular response to lept in stimulus	IDA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045639	positive regulation of my eloid cell differentiatio n	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IDA	biological_process
GO:0045906	negative regulation of va soconstriction	IEA	biological_process
GO:0046325	negative regulation of gl ucose import	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046850	regulation of bone remode ling	ISS	biological_process
GO:0046881	positive regulation of fo llicle-stimulating hormon e secretion	IEA	biological_process
GO:0048639	positive regulation of de velopmental growth	IDA	biological_process
GO:0050796	regulation of insulin sec retion	IEA	biological_process
GO:0050810	regulation of steroid bio synthetic process	IEA	biological_process
GO:0050892	intestinal absorption	IDA	biological_process
GO:0050901	leukocyte tethering or ro lling	IEA	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IDA	biological_process
GO:0051428	peptide hormone receptor binding	IBA	molecular_function
GO:0051726	regulation of cell cycle	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	ISS	biological_process
GO:0060587	regulation of lipoprotein lipid oxidation	IEA	biological_process
GO:0060612	adipose tissue developmen t	IEA	biological_process
GO:0061037	negative regulation of ca rtilage development	IEA	biological_process
GO:0070093	negative regulation of gl ucagon secretion	IEA	biological_process
GO:0071298	cellular response to L-as corbic acid	IEA	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0072604	interleukin-6 secretion	IDA	biological_process
GO:0072606	interleukin-8 secretion	IDA	biological_process
GO:0090335	regulation of brown fat c ell differentiation	ISS	biological_process
GO:0098868	bone growth	ISS	biological_process
GO:1900015	regulation of cytokine pr oduction involved in infl ammatory response	IDA	biological_process
GO:1900745	positive regulation of p3 8MAPK cascade	IDA	biological_process
GO:1904651	positive regulation of fa t cell apoptotic process	IEA	biological_process
GO:1990051	activation of protein kin ase C activity	IDA	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IBA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000486	negative regulation of gl utamine transport	IEA	biological_process
GO:2000491	positive regulation of he patic stellate cell activ ation	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001542	ovulation from ovarian fo llicle	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001819	positive regulation of cy tokine production	IEA	biological_process
GO:0001890	placenta development	IDA	biological_process
GO:0001932	regulation of protein pho sphorylation	IEA	biological_process
GO:0001936	regulation of endothelial cell proliferation	IDA	biological_process
GO:0002021	response to dietary exces s	IEA	biological_process
GO:0003300	cardiac muscle hypertroph y	IEA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IBA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0006111	regulation of gluconeogen esis	IEA	biological_process
GO:0006112	energy reserve metabolic process	IEA	biological_process
GO:0006112	energy reserve metabolic process	TAS	biological_process
GO:0006114	glycerol biosynthetic pro cess	IEA	biological_process
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006629	lipid metabolic process	IBA	biological_process
GO:0006635	fatty acid beta-oxidation	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IEA	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IBA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0008206	bile acid metabolic proce ss	IEA	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008343	adult feeding behavior	IEA	biological_process
GO:0008343	adult feeding behavior	ISS	biological_process
GO:0009062	fatty acid catabolic proc ess	IEA	biological_process
GO:0009892	negative regulation of me tabolic process	IEA	biological_process
GO:0010507	negative regulation of au tophagy	IEA	biological_process
GO:0010507	negative regulation of au tophagy	IDA	biological_process
GO:0010888	negative regulation of li pid storage	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0019222	regulation of metabolic p rocess	IEA	biological_process
GO:0019953	sexual reproduction	IEA	biological_process
GO:0019953	sexual reproduction	IMP	biological_process
GO:0021954	central nervous system ne uron development	IEA	biological_process
GO:0030073	insulin secretion	IEA	biological_process
GO:0030217	T cell differentiation	IEA	biological_process
GO:0030217	T cell differentiation	ISS	biological_process
GO:0030300	regulation of intestinal cholesterol absorption	IEA	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0032008	positive regulation of TO R signaling	IDA	biological_process
GO:0032099	negative regulation of ap petite	IEA	biological_process
GO:0032099	negative regulation of ap petite	ISS	biological_process
GO:0032310	prostaglandin secretion	IDA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032814	regulation of natural kil ler cell activation	IDA	biological_process
GO:0032817	regulation of natural kil ler cell proliferation	IDA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032868	response to insulin	IBA	biological_process
GO:0033197	response to vitamin E	IEA	biological_process
GO:0033210	leptin-mediated signaling pathway	IEA	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033686	positive regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035360	positive regulation of pe roxisome proliferator act ivated receptor signaling pathway	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0035630	bone mineralization invol ved in bone maturation	IEA	biological_process
GO:0038108	negative regulation of ap petite by leptin-mediated signaling pathway	ISS	biological_process
GO:0038108	negative regulation of ap petite by leptin-mediated signaling pathway	IBA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042269	regulation of natural kil ler cell mediated cytotox icity	IDA	biological_process
GO:0042307	positive regulation of pr otein import into nucleus	IEA	biological_process
GO:0042445	hormone metabolic process	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042755	eating behavior	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043270	positive regulation of io n transport	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	ISS	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0044320	cellular response to lept in stimulus	IDA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045598	regulation of fat cell di fferentiation	IEA	biological_process
GO:0045639	positive regulation of my eloid cell differentiatio n	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IDA	biological_process
GO:0045906	negative regulation of va soconstriction	IEA	biological_process
GO:0046325	negative regulation of gl ucose import	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046850	regulation of bone remode ling	IEA	biological_process
GO:0046850	regulation of bone remode ling	ISS	biological_process
GO:0046881	positive regulation of fo llicle-stimulating hormon e secretion	IEA	biological_process
GO:0048639	positive regulation of de velopmental growth	IDA	biological_process
GO:0050796	regulation of insulin sec retion	IEA	biological_process
GO:0050810	regulation of steroid bio synthetic process	IEA	biological_process
GO:0050892	intestinal absorption	IDA	biological_process
GO:0050901	leukocyte tethering or ro lling	IEA	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IEA	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IDA	biological_process
GO:0051428	peptide hormone receptor binding	IEA	molecular_function
GO:0051428	peptide hormone receptor binding	IBA	molecular_function
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0051726	regulation of cell cycle	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	ISS	biological_process
GO:0060587	regulation of lipoprotein lipid oxidation	IEA	biological_process
GO:0060612	adipose tissue developmen t	IEA	biological_process
GO:0061037	negative regulation of ca rtilage development	IEA	biological_process
GO:0070093	negative regulation of gl ucagon secretion	IEA	biological_process
GO:0071298	cellular response to L-as corbic acid	IEA	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0072604	interleukin-6 secretion	IDA	biological_process
GO:0072606	interleukin-8 secretion	IDA	biological_process
GO:0090335	regulation of brown fat c ell differentiation	IEA	biological_process
GO:0090335	regulation of brown fat c ell differentiation	ISS	biological_process
GO:0098868	bone growth	IEA	biological_process
GO:0098868	bone growth	ISS	biological_process
GO:1900015	regulation of cytokine pr oduction involved in infl ammatory response	IDA	biological_process
GO:1900180	regulation of protein loc alization to nucleus	IEA	biological_process
GO:1900745	positive regulation of p3 8MAPK cascade	IDA	biological_process
GO:1904651	positive regulation of fa t cell apoptotic process	IEA	biological_process
GO:1990051	activation of protein kin ase C activity	IDA	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IEA	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IBA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000486	negative regulation of gl utamine transport	IEA	biological_process
GO:2000491	positive regulation of he patic stellate cell activ ation	IEA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001890	placenta development	IDA	biological_process
GO:0001936	regulation of endothelial cell proliferation	IDA	biological_process
GO:0005179	hormone activity	IBA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006112	energy reserve metabolic process	TAS	biological_process
GO:0006629	lipid metabolic process	IBA	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IBA	biological_process
GO:0008343	adult feeding behavior	ISS	biological_process
GO:0010507	negative regulation of au tophagy	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0019953	sexual reproduction	IMP	biological_process
GO:0030217	T cell differentiation	ISS	biological_process
GO:0032008	positive regulation of TO R signaling	IDA	biological_process
GO:0032099	negative regulation of ap petite	ISS	biological_process
GO:0032310	prostaglandin secretion	IDA	biological_process
GO:0032814	regulation of natural kil ler cell activation	IDA	biological_process
GO:0032817	regulation of natural kil ler cell proliferation	IDA	biological_process
GO:0032868	response to insulin	IBA	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0038108	negative regulation of ap petite by leptin-mediated signaling pathway	ISS	biological_process
GO:0038108	negative regulation of ap petite by leptin-mediated signaling pathway	IBA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042269	regulation of natural kil ler cell mediated cytotox icity	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	ISS	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0044320	cellular response to lept in stimulus	IDA	biological_process
GO:0045765	regulation of angiogenesi s	IDA	biological_process
GO:0046325	negative regulation of gl ucose import	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046850	regulation of bone remode ling	ISS	biological_process
GO:0048639	positive regulation of de velopmental growth	IDA	biological_process
GO:0050892	intestinal absorption	IDA	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IDA	biological_process
GO:0051428	peptide hormone receptor binding	IBA	molecular_function
GO:0051726	regulation of cell cycle	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	ISS	biological_process
GO:0072604	interleukin-6 secretion	IDA	biological_process
GO:0072606	interleukin-8 secretion	IDA	biological_process
GO:0090335	regulation of brown fat c ell differentiation	ISS	biological_process
GO:0098868	bone growth	ISS	biological_process
GO:1900015	regulation of cytokine pr oduction involved in infl ammatory response	IDA	biological_process
GO:1900745	positive regulation of p3 8MAPK cascade	IDA	biological_process
GO:1990051	activation of protein kin ase C activity	IDA	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IBA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04932  Non-alcoholic fatty liver disease
hsa04152  AMPK signaling pathway
hsa04920  Adipocytokine signaling pathway

Diseases

Associated diseases	References
Amenorrhea	PMID: 22252944
Amyotrophic lateral sclerosis (ALS)	PMID: 18608101
Asthma	PMID: 19191138
Attention-deficit hyperactivity disorder (ADHD)	PMID: 11140838
Autism	PMID: 19058789
Azoospermia	PMID: 21735645
Behcet's disease	PMID: 16786343
Cancer	PMID: 12712467
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Defective endometrial receptivity	PMID: 25935494
Depression	PMID: 19382181
Diabetes	PMID: 18955751
Endometrial receptivity	PMID: 15142989
Endometriosis	PMID: 20825374
Female infertility	PMID: 15588162
Hypergonadotropic hypogonadism	PMID: 12950408
Hypogonadotropic hypogonadism	PMID: 22343341
Hypothalamic amenorrhea	PMID: 12151434
Idiopathic asthenozoospermia	PMID: 25419396
Leucocytospermia	PMID: 25081128
Male infertility	PMID: 17209884
Metabolic syndrome	PMID: 15978856
Multiple sclerosis	PMID: 19604093
Obesity	PMID: 12187394
Oligozoospermia	PMID: 17714215
Ovarian endometriosis	PMID: 25797583
Ovarian hyperstimulation syndrome(OHSS)	PMID: 15374699
Pelvic endometriosis	PMID: 20504092
Polycystic ovary syndrome (PCOS)	PMID: 26051098
Ovarian endometriosis	INFBASE25797583
Endometriosis (ovarian)	INFBASE25797583
Endometriosis associated infertility	INFBASE20504092
Endometriosis (Pelvic)	INFBASE20504092
Ovarian�endometriosis	INFBASE19544117
Endometriosis associated infertility	INFBASE18958774
Idiopathic infertility	INFBASE16269446
Female infertility	INFBASE16190409
Endometriosis	INFBASE12773447
Preeclampsia	PMID: 18958929
Premature ovarian failure ( POF)	PMID: 19609224
Primary infertility	PMID: 18665375
Psychiatric disorders	PMID: 19086053
Recurrent miscarriage	PMID: 26952510
Schizophrenia	PMID: 14720418
Sertoli cell-only syndrome (SCOS)	PMID: 17212806
Unexplained recurrent pregnancy loss (RPL)	PMID: 22265003
Varicocele	PMID: 25081128

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17706208	Endometrio sis	141 (63 women w ith surgically confirmed stage II-IV endometr iosis, 78 women who were surgi cally confirmed to be free of endometriosis)		MIF MCP-1 INFG LEP CA-127	Show abstract
26242176	Endometrio sis	25 (15 patients who underwent surgery for adn exal masses and infertility, 1 0 controls who underwent surge ry for tubal li gation)	Female infertility		Show abstract
21848410	Endometrio sis	86 (58 women wi th endometriosi s and 28 women undergoing tuba l ligation)		Leptin IL-8	Show abstract
19230876	Endometrio sis			MCP-1 MIF LEP and CA-125	Show abstract
12773447	Endometrio sis	78 (60 women un dergoing laparo scopy for endom etriosis, 18 co ntrols undergoi ng tubal steril ization)			Show abstract
16269446	Endometrio sis	108 (60 patient s were diagnose d with endometr iosis, 10 with idiopathic infe rtility, 38 had undergone tuba l ligation or r eanastomosis (c ontrol group))	Female infertility	LEP	Show abstract
18958774	Endometrio sis	56 patients bei ng diagnosed fo r infertility a nd/or pelvic pa in	Female infertility		Show abstract
16190409	Endometrio sis		Female infertility	LEP	Show abstract
20504092	Endometrio sis (Pelvi c)	50 (15 had endo metriosis (case s), 35 had no e ndometriosis (c ontrols))			Show abstract
19544117	Endometrio sis (ovari an)	37 (11 women wi th 'superficial ' endometriomas located at the ovarian surfac e, 16 patients with 'deep' int ra-ovarian endo metriomas, 10 w omen undergoing laparoscopy fo r unexplained i nfertility and not affected by pelvic and/or ovarian endomet riosis were con			Show abstract
15465848	Endometrio sis	42 (30 patients with severe/mo derate endometr iosis, 12 ferti le controls)		LEP LEPR	Show abstract
20047585	Endometrio sis	60 (40 patients with endometri osis, 20 patien ts did not have endometriosis)		COX-2 Leptin	Show abstract
25797583	Endometrio sis (ovari an)	98 (58 women wi th ovarian endo metriosis (case s), 40 healthy women undergoin g sterilization or patients wi th benign ovari an cysts (contr ols))	Female infertility	IL6 IL8 PAEP LEP	Show abstract
20825374	Endometrio sis	28 infertile wo men with endome triosis (study group), 23 wome n with fallopia n-associated in fertility (cont rols), and 24 w omen with myoma (controls)	Female infertility	Leptin MCP-1 andTNF-alpha levels	Show abstract