Endometriosis Knowledgebase

Search Result

Gene id

3956

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LGALS1 Gene UCSC Ensembl

Aliases

GAL1, GBP

Gene name

galectin 1

Alternate names

galectin-1, 14 kDa laminin-binding protein, 14 kDa lectin, HBL, HLBP14, HPL, S-Lac lectin 1, beta-galactoside-binding lectin L-14-I, beta-galactoside-binding protein 14kDa, gal-1, galaptin, lactose-binding lectin 1, lectin, galactoside-binding, soluble, 1, putative MA,

Gene location

22q13.1 (37675605: 37679801) Exons: 4 NC_000022.11

Gene summary(Entrez)

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]

OMIM

150570

Protein Summary

Protein general information

P09382

Name: Galectin 1 (Gal 1) (14 kDa laminin binding protein) (HLBP14) (14 kDa lectin) (Beta galactoside binding lectin L 14 I) (Galaptin) (HBL) (HPL) (Lactose binding lectin 1) (Lectin galactoside binding soluble 1) (Putative MAPK activating protein PM12) (S Lac l

Length: 135 Mass: 14,716

Tissue specificity: Expressed in placenta, maternal decidua and fetal membranes. Within placenta, expressed in trophoblasts, stromal cells, villous endothelium, syncytiotrophoblast apical membrane and villous stroma. Within fetal membranes, expressed in a

Sequence

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQRE
AVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD

Structural information

Protein Domains	Galectin. (4-135)
Interpro:	IPR013320 IPR001079
Prosite:	PS51304
Pfam:	PF00337
PDB:	1GZW 1W6M 1W6N 1W6O 1W6P 1W6Q 2KM2 2ZKN 3OY8 3OYW 3T2T 3W58 3W59 4Q1P 4Q1R 4Q26 4Q27 4Q2F 4XBL 4Y1U 4Y1V 4Y1X 4Y1Y 4Y1Z 4Y20 4Y22 4Y24
PDBsum:	1GZW 1W6M 1W6N 1W6O 1W6P 1W6Q 2KM2 2ZKN 3OY8 3OYW 3T2T 3W58 3W59 4Q1P 4Q1R 4Q26 4Q27 4Q2F 4XBL 4Y1U 4Y1V 4Y1X 4Y1Y 4Y1Z 4Y20 4Y22 4Y24
DIP:	46153
MINT:	3306493
STRING:	ENSP00000215909;

Other Databases

GeneCards: LGALS1; Malacards: LGALS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001948	glycoprotein binding	IEA	molecular_function
GO:0002317	plasma cell differentiati on	IEA	biological_process
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010812	negative regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	IEA	biological_process
GO:0030395	lactose binding	IEA	molecular_function
GO:0031295	T cell costimulation	IEA	biological_process
GO:0033555	multicellular organismal response to stress	IEA	biological_process
GO:0034120	positive regulation of er ythrocyte aggregation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043236	laminin binding	IEA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045445	myoblast differentiation	IEA	biological_process
GO:0046598	positive regulation of vi ral entry into host cell	IDA	biological_process
GO:0048678	response to axon injury	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:2001200	positive regulation of de ndritic cell differentiat ion	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001948	glycoprotein binding	IEA	molecular_function
GO:0002317	plasma cell differentiati on	IEA	biological_process
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010812	negative regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	IEA	biological_process
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030395	lactose binding	IEA	molecular_function
GO:0031295	T cell costimulation	IEA	biological_process
GO:0033555	multicellular organismal response to stress	IEA	biological_process
GO:0034120	positive regulation of er ythrocyte aggregation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043236	laminin binding	IEA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045445	myoblast differentiation	IEA	biological_process
GO:0046598	positive regulation of vi ral entry into host cell	IDA	biological_process
GO:0048678	response to axon injury	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:2001200	positive regulation of de ndritic cell differentiat ion	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0046598	positive regulation of vi ral entry into host cell	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2001200	positive regulation of de ndritic cell differentiat ion	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component

Diseases

Associated diseases	References
Cancer	PMID: 19730683
Endometriosis	PMID: 25473847
Endometriosis	INFBASE25473847

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25473847	Endometrio sis			26 (10 healthy controls, 16 pa tients with end ometriosis)	Female infertility		Show abstract