Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3965
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol LGALS9   Gene   UCSC   Ensembl
Aliases HUAT, LGALS9A
Gene name galectin 9
Alternate names galectin-9, ecalectin, gal-9, lectin, galactoside-binding, soluble, 9, tumor antigen HOM-HD-21, urate transporter/channel protein,
Gene location 17q11.2 (27631147: 27649559)     Exons: 12     NC_000017.11
Gene summary(Entrez) The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
OMIM 601879

Protein Summary
Protein general information O00182  

Name: Galectin-9 (Gal-9) (Ecalectin) (Tumor antigen HOM-HD-21)

Length: 355  Mass: 39,518

Tissue specificity: Peripheral blood leukocytes and lymphatic tissues. Expressed in lung, liver, breast and kidney with higher levels in tumor endothelial cells than normal endothelium (at protein level) (PubMed

Sequence MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCN
TRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNP
RTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPM
PFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPF
VRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Structural information
Protein Domains
 Galectin (17-148)
Galectin (227-355)
Interpro:  IPR013320 IPR001079
Prosite:   PS51304

Pfam:  		 PF00337
CDD:   cd00070

PDB:  		 2EAK 2EAL 2YY1 2ZHK 2ZHL 2ZHM 2ZHN 3LSD 3LSE 3NV1 3NV2 3NV3 3NV4 3WLU 3WV6
PDBsum:   2EAK 2EAL 2YY1 2ZHK 2ZHL 2ZHM 2ZHN 3LSD 3LSE 3NV1 3NV2 3NV3 3NV4 3WLU 3WV6
STRING:   ENSP00000378856;
Other Databases GeneCards:  LGALS9;  Malacards:  LGALS9

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0002519 natural killer cell toler
ance induction
 IMP biological_process
GO:0004871 signal transducer activit
y
 IMP molecular_function
GO:0005534 galactose binding
 TAS molecular_function
GO:0005615 extracellular space
 IDA cellular_component
GO:0005622 intracellular
 IDA cellular_component
GO:0005622 intracellular
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0006935 chemotaxis
 IEA biological_process
GO:0006954 inflammatory response
 IDA biological_process
GO:0007565 female pregnancy
 IDA biological_process
GO:0010628 positive regulation of ge
ne expression
 IDA biological_process
GO:0010629 negative regulation of ge
ne expression
 IDA biological_process
GO:0010629 negative regulation of ge
ne expression
 IMP biological_process
GO:0019899 enzyme binding
 IPI molecular_function
GO:0030246 carbohydrate binding
 IDA molecular_function
GO:0032496 response to lipopolysacch
aride
 IMP biological_process
GO:0032682 negative regulation of ch
emokine production
 IMP biological_process
GO:0032689 negative regulation of in
terferon-gamma production
 IDA biological_process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 IMP biological_process
GO:0032753 positive regulation of in
terleukin-4 production
 IDA biological_process
GO:0032753 positive regulation of in
terleukin-4 production
 IMP biological_process
GO:0032834 positive regulation of CD
4-positive, CD25-positive
, alpha-beta regulatory T
cell differentiation inv
olved in immune response
 IDA biological_process
GO:0038066 p38MAPK cascade
 IDA biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 IMP biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IMP biological_process
GO:0043305 negative regulation of ma
st cell degranulation
 IMP biological_process
GO:0045953 negative regulation of na
tural killer cell mediate
d cytotoxicity
 IDA biological_process
GO:0046007 negative regulation of ac
tivated T cell proliferat
ion
 IMP biological_process
GO:0046598 positive regulation of vi
ral entry into host cell
 IDA biological_process
GO:0048030 disaccharide binding
 IMP molecular_function
GO:0050718 positive regulation of in
terleukin-1 beta secretio
n
 IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
 IMP biological_process
GO:0060135 maternal process involved
in female pregnancy
 IDA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0070241 positive regulation of ac
tivated T cell autonomous
cell death
 IDA biological_process
GO:0070371 ERK1 and ERK2 cascade
 IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IMP biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IMP biological_process
GO:0070555 response to interleukin-1
 IDA biological_process
GO:0071346 cellular response to inte
rferon-gamma
 IDA biological_process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 IDA biological_process
GO:0071639 positive regulation of mo
nocyte chemotactic protei
n-1 production
 IMP biological_process
GO:0098586 cellular response to viru
s
 IMP biological_process
GO:1902715 positive regulation of in
terferon-gamma secretion
 IDA biological_process
GO:1904469 positive regulation of tu
mor necrosis factor secre
tion
 IDA biological_process
GO:2000484 positive regulation of in
terleukin-8 secretion
 IMP biological_process
GO:2000510 positive regulation of de
ndritic cell chemotaxis
 IMP biological_process
GO:2000562 negative regulation of CD
4-positive, alpha-beta T
cell proliferation
 IDA biological_process
GO:2000563 positive regulation of CD
4-positive, alpha-beta T
cell proliferation
 IDA biological_process
GO:2000667 positive regulation of in
terleukin-13 secretion
 IDA biological_process
GO:2000670 positive regulation of de
ndritic cell apoptotic pr
ocess
 IDA biological_process
GO:2000778 positive regulation of in
terleukin-6 secretion
 IMP biological_process
GO:2001181 positive regulation of in
terleukin-10 secretion
 IDA biological_process
GO:2001181 positive regulation of in
terleukin-10 secretion
 IDA biological_process
GO:2001184 positive regulation of in
terleukin-12 secretion
 IMP biological_process
GO:2001184 positive regulation of in
terleukin-12 secretion
 IMP biological_process
GO:2001190 positive regulation of T
cell activation via T cel
l receptor contact with a
ntigen bound to MHC molec
ule on antigen presenting
cell
 IDA biological_process
GO:2001200 positive regulation of de
ndritic cell differentiat
ion
 IMP biological_process
GO:2001269 positive regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic signaling pathway
 IMP biological_process
GO:0032673 regulation of interleukin
-4 production
 IDA biological_process
GO:0032674 regulation of interleukin
-5 production
 IDA biological_process
GO:0034134 toll-like receptor 2 sign
aling pathway
 IDA biological_process
GO:0034142 toll-like receptor 4 sign
aling pathway
 IDA biological_process
GO:0097029 mature conventional dendr
itic cell differentiation
 IMP biological_process
GO:1900744 regulation of p38MAPK cas
cade
 IMP biological_process
GO:0002376 immune system process
 IEA biological_process
GO:0002519 natural killer cell toler
ance induction
 IMP biological_process
GO:0004871 signal transducer activit
y
 IMP molecular_function
GO:0005534 galactose binding
 TAS molecular_function
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 IEA cellular_component
GO:0005615 extracellular space
 IDA cellular_component
GO:0005622 intracellular
 IDA cellular_component
GO:0005622 intracellular
 IDA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0006935 chemotaxis
 IEA biological_process
GO:0006954 inflammatory response
 IDA biological_process
GO:0007565 female pregnancy
 IDA biological_process
GO:0010628 positive regulation of ge
ne expression
 IDA biological_process
GO:0010629 negative regulation of ge
ne expression
 IDA biological_process
GO:0010629 negative regulation of ge
ne expression
 IMP biological_process
GO:0019899 enzyme binding
 IPI molecular_function
GO:0030246 carbohydrate binding
 IEA molecular_function
GO:0030246 carbohydrate binding
 IEA molecular_function
GO:0030246 carbohydrate binding
 IDA molecular_function
GO:0032496 response to lipopolysacch
aride
 IMP biological_process
GO:0032682 negative regulation of ch
emokine production
 IMP biological_process
GO:0032689 negative regulation of in
terferon-gamma production
 IDA biological_process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 IMP biological_process
GO:0032753 positive regulation of in
terleukin-4 production
 IDA biological_process
GO:0032753 positive regulation of in
terleukin-4 production
 IMP biological_process
GO:0032834 positive regulation of CD
4-positive, CD25-positive
, alpha-beta regulatory T
cell differentiation inv
olved in immune response
 IDA biological_process
GO:0038066 p38MAPK cascade
 IDA biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 IMP biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IMP biological_process
GO:0043305 negative regulation of ma
st cell degranulation
 IMP biological_process
GO:0045953 negative regulation of na
tural killer cell mediate
d cytotoxicity
 IDA biological_process
GO:0046007 negative regulation of ac
tivated T cell proliferat
ion
 IMP biological_process
GO:0046598 positive regulation of vi
ral entry into host cell
 IDA biological_process
GO:0048030 disaccharide binding
 IMP molecular_function
GO:0050718 positive regulation of in
terleukin-1 beta secretio
n
 IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
 IMP biological_process
GO:0060135 maternal process involved
in female pregnancy
 IDA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0070241 positive regulation of ac
tivated T cell autonomous
cell death
 IDA biological_process
GO:0070371 ERK1 and ERK2 cascade
 IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IMP biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IMP biological_process
GO:0070555 response to interleukin-1
 IDA biological_process
GO:0071346 cellular response to inte
rferon-gamma
 IDA biological_process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 IDA biological_process
GO:0071639 positive regulation of mo
nocyte chemotactic protei
n-1 production
 IMP biological_process
GO:0098586 cellular response to viru
s
 IMP biological_process
GO:1902715 positive regulation of in
terferon-gamma secretion
 IDA biological_process
GO:1904469 positive regulation of tu
mor necrosis factor secre
tion
 IDA biological_process
GO:2000484 positive regulation of in
terleukin-8 secretion
 IMP biological_process
GO:2000510 positive regulation of de
ndritic cell chemotaxis
 IMP biological_process
GO:2000562 negative regulation of CD
4-positive, alpha-beta T
cell proliferation
 IDA biological_process
GO:2000563 positive regulation of CD
4-positive, alpha-beta T
cell proliferation
 IDA biological_process
GO:2000667 positive regulation of in
terleukin-13 secretion
 IDA biological_process
GO:2000670 positive regulation of de
ndritic cell apoptotic pr
ocess
 IDA biological_process
GO:2000778 positive regulation of in
terleukin-6 secretion
 IMP biological_process
GO:2001181 positive regulation of in
terleukin-10 secretion
 IDA biological_process
GO:2001181 positive regulation of in
terleukin-10 secretion
 IDA biological_process
GO:2001184 positive regulation of in
terleukin-12 secretion
 IMP biological_process
GO:2001184 positive regulation of in
terleukin-12 secretion
 IMP biological_process
GO:2001190 positive regulation of T
cell activation via T cel
l receptor contact with a
ntigen bound to MHC molec
ule on antigen presenting
cell
 IDA biological_process
GO:2001200 positive regulation of de
ndritic cell differentiat
ion
 IMP biological_process
GO:2001269 positive regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic signaling pathway
 IMP biological_process
GO:0032673 regulation of interleukin
-4 production
 IDA biological_process
GO:0032674 regulation of interleukin
-5 production
 IDA biological_process
GO:0034134 toll-like receptor 2 sign
aling pathway
 IDA biological_process
GO:0034142 toll-like receptor 4 sign
aling pathway
 IDA biological_process
GO:0097029 mature conventional dendr
itic cell differentiation
 IMP biological_process
GO:1900744 regulation of p38MAPK cas
cade
 IMP biological_process
GO:0002519 natural killer cell toler
ance induction
 IMP biological_process
GO:0004871 signal transducer activit
y
 IMP molecular_function
GO:0005534 galactose binding
 TAS molecular_function
GO:0005615 extracellular space
 IDA cellular_component
GO:0005622 intracellular
 IDA cellular_component
GO:0005622 intracellular
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0006954 inflammatory response
 IDA biological_process
GO:0007565 female pregnancy
 IDA biological_process
GO:0010628 positive regulation of ge
ne expression
 IDA biological_process
GO:0010629 negative regulation of ge
ne expression
 IDA biological_process
GO:0010629 negative regulation of ge
ne expression
 IMP biological_process
GO:0019899 enzyme binding
 IPI molecular_function
GO:0030246 carbohydrate binding
 IDA molecular_function
GO:0032496 response to lipopolysacch
aride
 IMP biological_process
GO:0032682 negative regulation of ch
emokine production
 IMP biological_process
GO:0032689 negative regulation of in
terferon-gamma production
 IDA biological_process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
 IMP biological_process
GO:0032753 positive regulation of in
terleukin-4 production
 IDA biological_process
GO:0032753 positive regulation of in
terleukin-4 production
 IMP biological_process
GO:0032834 positive regulation of CD
4-positive, CD25-positive
, alpha-beta regulatory T
cell differentiation inv
olved in immune response
 IDA biological_process
GO:0038066 p38MAPK cascade
 IDA biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 IMP biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IMP biological_process
GO:0043305 negative regulation of ma
st cell degranulation
 IMP biological_process
GO:0045953 negative regulation of na
tural killer cell mediate
d cytotoxicity
 IDA biological_process
GO:0046007 negative regulation of ac
tivated T cell proliferat
ion
 IMP biological_process
GO:0046598 positive regulation of vi
ral entry into host cell
 IDA biological_process
GO:0048030 disaccharide binding
 IMP molecular_function
GO:0050718 positive regulation of in
terleukin-1 beta secretio
n
 IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
 IMP biological_process
GO:0060135 maternal process involved
in female pregnancy
 IDA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0070241 positive regulation of ac
tivated T cell autonomous
cell death
 IDA biological_process
GO:0070371 ERK1 and ERK2 cascade
 IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IMP biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IMP biological_process
GO:0070555 response to interleukin-1
 IDA biological_process
GO:0071346 cellular response to inte
rferon-gamma
 IDA biological_process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 IDA biological_process
GO:0071639 positive regulation of mo
nocyte chemotactic protei
n-1 production
 IMP biological_process
GO:0098586 cellular response to viru
s
 IMP biological_process
GO:1902715 positive regulation of in
terferon-gamma secretion
 IDA biological_process
GO:1904469 positive regulation of tu
mor necrosis factor secre
tion
 IDA biological_process
GO:2000484 positive regulation of in
terleukin-8 secretion
 IMP biological_process
GO:2000510 positive regulation of de
ndritic cell chemotaxis
 IMP biological_process
GO:2000562 negative regulation of CD
4-positive, alpha-beta T
cell proliferation
 IDA biological_process
GO:2000563 positive regulation of CD
4-positive, alpha-beta T
cell proliferation
 IDA biological_process
GO:2000667 positive regulation of in
terleukin-13 secretion
 IDA biological_process
GO:2000670 positive regulation of de
ndritic cell apoptotic pr
ocess
 IDA biological_process
GO:2000778 positive regulation of in
terleukin-6 secretion
 IMP biological_process
GO:2001181 positive regulation of in
terleukin-10 secretion
 IDA biological_process
GO:2001181 positive regulation of in
terleukin-10 secretion
 IDA biological_process
GO:2001184 positive regulation of in
terleukin-12 secretion
 IMP biological_process
GO:2001184 positive regulation of in
terleukin-12 secretion
 IMP biological_process
GO:2001190 positive regulation of T
cell activation via T cel
l receptor contact with a
ntigen bound to MHC molec
ule on antigen presenting
cell
 IDA biological_process
GO:2001200 positive regulation of de
ndritic cell differentiat
ion
 IMP biological_process
GO:2001269 positive regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic signaling pathway
 IMP biological_process
GO:0032673 regulation of interleukin
-4 production
 IDA biological_process
GO:0032674 regulation of interleukin
-5 production
 IDA biological_process
GO:0034134 toll-like receptor 2 sign
aling pathway
 IDA biological_process
GO:0034142 toll-like receptor 4 sign
aling pathway
 IDA biological_process
GO:0097029 mature conventional dendr
itic cell differentiation
 IMP biological_process
GO:1900744 regulation of p38MAPK cas
cade
 IMP biological_process

Diseases

Associated diseases References
Female infertility INFBASE29202955
Endometriosis INFBASE29202955

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
29202955 Endometrio
sis
135 (77 endomet
riosis patients
, 28 gynecologi
c controls, 30
healthy women)
 Female infertility
Show abstract