Endometriosis Knowledgebase

Search Result

Gene id

4025

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LPO Gene UCSC Ensembl

Aliases

SPO

Gene name

lactoperoxidase

Alternate names

lactoperoxidase, salivary peroxidase,

Gene location

17q22 (58238425: 58268517) Exons: 14 NC_000017.11

Gene summary(Entrez)

This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the generation of the antimicrobial substance hypothiocyanous acid. This gene is present in a gene cluster on chromosome 17. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]

OMIM

150205

Protein Summary

Protein general information

P22079

Name: Lactoperoxidase (LPO) (EC 1.11.1.7) (Salivary peroxidase) (SPO)

Length: 712 Mass: 80,288

Tissue specificity: Mammary gland; milk and salivary gland. Found in bronchial submucosal glands. {ECO

Sequence

MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAMSSETPTSRQLSEYLK
HAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRRK
PALGAANRALARWLPAEYEDGLSLPFGWTPGKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVD
HDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTTARVPCFLAGDSRASE
HILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAFVQIITFRDYLPILLGDHMQKWIPPYQGYSE
SVDPRISNVFTFAFRFGHLEVPSSMFRLDENYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMK
QNKMMTGELRNKLFQPTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDSLQKMSFSRLVCDNTR
ITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN

Structural information

Interpro:	IPR010255 IPR019791 IPR029587
Prosite:	PS50292
Pfam:	PF03098
STRING:	ENSP00000262290;

Other Databases

GeneCards: LPO; Malacards: LPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001580	detection of chemical sti mulus involved in sensory perception of bitter tas te	IDA	biological_process
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006979	response to oxidative str ess	NAS	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0018969	thiocyanate metabolic pro cess	IEA	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0036393	thiocyanate peroxidase ac tivity	IDA	molecular_function
GO:0042742	defense response to bacte rium	IDA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0001580	detection of chemical sti mulus involved in sensory perception of bitter tas te	IDA	biological_process
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0006979	response to oxidative str ess	NAS	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0018969	thiocyanate metabolic pro cess	IEA	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0036393	thiocyanate peroxidase ac tivity	IEA	molecular_function
GO:0036393	thiocyanate peroxidase ac tivity	IDA	molecular_function
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0042742	defense response to bacte rium	IDA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0001580	detection of chemical sti mulus involved in sensory perception of bitter tas te	IDA	biological_process
GO:0005615	extracellular space	IDA	cellular_component
GO:0006979	response to oxidative str ess	NAS	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0036393	thiocyanate peroxidase ac tivity	IDA	molecular_function
GO:0042742	defense response to bacte rium	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04970 Salivary secretion

Diseases

Associated diseases	References
Cancer	PMID: 19505917
Endometriosis	PMID: 11523228
Male infertility	PMID: 24082556
Endometriosis associated infertility	INFBASE11523228
Endometriosis	INFBASE11523228

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11523228	Endometrio sis				Female infertility	LPO SOD	Show abstract