Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 4057
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol LTF   Gene   UCSC   Ensembl
Aliases GIG12, HEL110, HLF2, LF
Gene name lactotransferrin
Alternate names lactotransferrin, epididymis luminal protein 110, growth-inhibiting protein 12, kaliocin-1, lactoferricin, lactoferroxin, neutrophil lactoferrin, talalactoferrin,
Gene location 3p21.31 (46485233: 46436004)     Exons: 22     NC_000003.12
Gene summary(Entrez) This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an important component of the non-specific immune system. The protein demonstrates a broad spectrum of properties, including regulation of iron homeostasis, host defense against a broad range of microbial infections, anti-inflammatory activity, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Antimicrobial, antiviral, antifungal and antiparasitic activity has been found for this protein and its peptides. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
OMIM 150210

Protein Summary

Protein general information P02788  

Name: Lactotransferrin (Lactoferrin) (EC 3.4.21. ) (Growth inhibiting protein 12) (Talalactoferrin) [Cleaved into: Lactoferricin H (Lfcin H); Kaliocin 1; Lactoferroxin A; Lactoferroxin B; Lactoferroxin C]

Length: 710  Mass: 78,182

Tissue specificity: High levels are found in saliva and tears, intermediate levels in serum and plasma, and low levels in urine. In kidney, detected in the distal collecting tubules in the medulla but not in the cortical region or in blood vessels. Detect

Sequence MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADA
VTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGT
LRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDV
AFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELR
KCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRP
VEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCAL
CIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK
TTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK
Structural information
Protein Domains
Transferrin-like (25-352)
Transferrin-like (364-695)
Interpro:  IPR030684 IPR016357 IPR001156 IPR018195
Prosite:   PS00205 PS00206 PS00207 PS51408

Pfam:  
PF00405

PDB:  
1B0L 1BKA 1CB6 1DSN 1EH3 1FCK 1H43 1H44 1H45 1HSE 1L5T 1LCF 1LCT 1LFG 1LFH 1LFI 1LGB 1N76 1SQY 1U62 1VFD 1VFE 1XV4 1XV7 1Z6V 1Z6W 2BJJ 2DP4 2GMC 2GMD 2HD4 2PMS
PDBsum:   1B0L 1BKA 1CB6 1DSN 1EH3 1FCK 1H43 1H44 1H45 1HSE 1L5T 1LCF 1LCT 1LFG 1LFH 1LFI 1LGB 1N76 1SQY 1U62 1VFD 1VFE 1XV4 1XV7 1Z6V 1Z6W 2BJJ 2DP4 2GMC 2GMD 2HD4 2PMS

DIP:  
41354
MINT:   1511753
STRING:   ENSP00000231751;
Other Databases GeneCards:  LTF;  Malacards:  LTF

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001503 ossification
IEA biological_process
GO:0001817 regulation of cytokine pr
oduction
IDA biological_process
GO:0001895 retina homeostasis
IEP biological_process
GO:0002227 innate immune response in
mucosa
IDA biological_process
GO:0003677 DNA binding
IEA molecular_function
GO:0004252 serine-type endopeptidase
activity
IEA molecular_function
GO:0005506 iron ion binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IMP cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006508 proteolysis
IEA biological_process
GO:0006811 ion transport
IEA biological_process
GO:0006959 humoral immune response
TAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019732 antifungal humoral respon
se
IDA biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0031665 negative regulation of li
popolysaccharide-mediated
signaling pathway
IDA biological_process
GO:0032680 regulation of tumor necro
sis factor production
IDA biological_process
GO:0032780 negative regulation of AT
Pase activity
IMP biological_process
GO:0033214 iron assimilation by chel
ation and transport
TAS biological_process
GO:0033690 positive regulation of os
teoblast proliferation
IDA biological_process
GO:0034145 positive regulation of to
ll-like receptor 4 signal
ing pathway
IMP biological_process
GO:0042581 specific granule
IDA cellular_component
GO:0043066 negative regulation of ap
optotic process
ISS biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
IDA biological_process
GO:0043234 protein complex
IDA cellular_component
GO:0043539 protein serine/threonine
kinase activator activity
IDA molecular_function
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0044793 negative regulation by ho
st of viral process
IMP biological_process
GO:0045071 negative regulation of vi
ral genome replication
IMP biological_process
GO:0045454 cell redox homeostasis
TAS biological_process
GO:0045669 positive regulation of os
teoblast differentiation
IDA biological_process
GO:0048525 negative regulation of vi
ral process
IMP biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0060349 bone morphogenesis
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0097013 phagocytic vesicle lumen
TAS cellular_component
GO:0097013 phagocytic vesicle lumen
TAS cellular_component
GO:1900159 positive regulation of bo
ne mineralization involve
d in bone maturation
ISS biological_process
GO:1900229 negative regulation of si
ngle-species biofilm form
ation in or on host organ
ism
IDA biological_process
GO:1902732 positive regulation of ch
ondrocyte proliferation
IDA biological_process
GO:2000308 negative regulation of tu
mor necrosis factor (liga
nd) superfamily member 11
production
ISS biological_process
GO:2001205 negative regulation of os
teoclast development
ISS biological_process
GO:0001503 ossification
IEA biological_process
GO:0001817 regulation of cytokine pr
oduction
IEA biological_process
GO:0001817 regulation of cytokine pr
oduction
IDA biological_process
GO:0001895 retina homeostasis
IEP biological_process
GO:0002227 innate immune response in
mucosa
IDA biological_process
GO:0002376 immune system process
IEA biological_process
GO:0003677 DNA binding
IEA molecular_function
GO:0004252 serine-type endopeptidase
activity
IEA molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0005506 iron ion binding
IEA molecular_function
GO:0005506 iron ion binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IMP cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006508 proteolysis
IEA biological_process
GO:0006810 transport
IEA biological_process
GO:0006811 ion transport
IEA biological_process
GO:0006959 humoral immune response
TAS biological_process
GO:0008201 heparin binding
IEA molecular_function
GO:0008201 heparin binding
IDA molecular_function
GO:0008233 peptidase activity
IEA molecular_function
GO:0008233 peptidase activity
IEA molecular_function
GO:0008236 serine-type peptidase act
ivity
IEA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0016787 hydrolase activity
IEA molecular_function
GO:0019731 antibacterial humoral res
ponse
IEA biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019732 antifungal humoral respon
se
IEA biological_process
GO:0019732 antifungal humoral respon
se
IDA biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0031665 negative regulation of li
popolysaccharide-mediated
signaling pathway
IDA biological_process
GO:0032680 regulation of tumor necro
sis factor production
IDA biological_process
GO:0032780 negative regulation of AT
Pase activity
IMP biological_process
GO:0033214 iron assimilation by chel
ation and transport
TAS biological_process
GO:0033690 positive regulation of os
teoblast proliferation
IDA biological_process
GO:0034145 positive regulation of to
ll-like receptor 4 signal
ing pathway
IMP biological_process
GO:0042581 specific granule
IDA cellular_component
GO:0042742 defense response to bacte
rium
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
ISS biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
IDA biological_process
GO:0043234 protein complex
IDA cellular_component
GO:0043539 protein serine/threonine
kinase activator activity
IDA molecular_function
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0044793 negative regulation by ho
st of viral process
IMP biological_process
GO:0045071 negative regulation of vi
ral genome replication
IMP biological_process
GO:0045454 cell redox homeostasis
TAS biological_process
GO:0045669 positive regulation of os
teoblast differentiation
IDA biological_process
GO:0046872 metal ion binding
IEA molecular_function
GO:0048525 negative regulation of vi
ral process
IMP biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0055072 iron ion homeostasis
IEA biological_process
GO:0060349 bone morphogenesis
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0097013 phagocytic vesicle lumen
TAS cellular_component
GO:0097013 phagocytic vesicle lumen
TAS cellular_component
GO:1900159 positive regulation of bo
ne mineralization involve
d in bone maturation
ISS biological_process
GO:1900229 negative regulation of si
ngle-species biofilm form
ation in or on host organ
ism
IDA biological_process
GO:1902732 positive regulation of ch
ondrocyte proliferation
IDA biological_process
GO:2000308 negative regulation of tu
mor necrosis factor (liga
nd) superfamily member 11
production
ISS biological_process
GO:2001205 negative regulation of os
teoclast development
ISS biological_process
GO:0001817 regulation of cytokine pr
oduction
IDA biological_process
GO:0001895 retina homeostasis
IEP biological_process
GO:0002227 innate immune response in
mucosa
IDA biological_process
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0005506 iron ion binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IMP cellular_component
GO:0006959 humoral immune response
TAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019732 antifungal humoral respon
se
IDA biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0031665 negative regulation of li
popolysaccharide-mediated
signaling pathway
IDA biological_process
GO:0032680 regulation of tumor necro
sis factor production
IDA biological_process
GO:0032780 negative regulation of AT
Pase activity
IMP biological_process
GO:0033214 iron assimilation by chel
ation and transport
TAS biological_process
GO:0033690 positive regulation of os
teoblast proliferation
IDA biological_process
GO:0034145 positive regulation of to
ll-like receptor 4 signal
ing pathway
IMP biological_process
GO:0042581 specific granule
IDA cellular_component
GO:0043066 negative regulation of ap
optotic process
ISS biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
IDA biological_process
GO:0043234 protein complex
IDA cellular_component
GO:0043539 protein serine/threonine
kinase activator activity
IDA molecular_function
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0044793 negative regulation by ho
st of viral process
IMP biological_process
GO:0045071 negative regulation of vi
ral genome replication
IMP biological_process
GO:0045454 cell redox homeostasis
TAS biological_process
GO:0045669 positive regulation of os
teoblast differentiation
IDA biological_process
GO:0048525 negative regulation of vi
ral process
IMP biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0060349 bone morphogenesis
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0097013 phagocytic vesicle lumen
TAS cellular_component
GO:0097013 phagocytic vesicle lumen
TAS cellular_component
GO:1900159 positive regulation of bo
ne mineralization involve
d in bone maturation
ISS biological_process
GO:1900229 negative regulation of si
ngle-species biofilm form
ation in or on host organ
ism
IDA biological_process
GO:1902732 positive regulation of ch
ondrocyte proliferation
IDA biological_process
GO:2000308 negative regulation of tu
mor necrosis factor (liga
nd) superfamily member 11
production
ISS biological_process
GO:2001205 negative regulation of os
teoclast development
ISS biological_process

Diseases

Associated diseases References
Aggressive periodontitis PMID: 18973542
Azoospermia PMID: 22182811
Endometriosis PMID: 16644090
Endometriosis PMID: 17611835
Fertilization rate PMID: 17094987
Idiopathic asthenozoospermia PMID: 23455884
Nephropathy PMID: 11748357
Oligozoospermia PMID: 22182811
Endometriosis INFBASE17611835

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17611835 Endometrio
sis

32 (18 patients
with endometri
osis, 14 contro
ls without endo
metriosis)
Lactoferrin
myeloperoxidase
cancer antigen 125
Show abstract
16644090 Endometrio
sis

78 (49 women wi
th endometriosi
s, 29 patients
with functional
follicle ovari
an cysts)
lactoferrin
Show abstract