Endometriosis Knowledgebase

Search Result

Gene id

4088

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SMAD3 Gene UCSC Ensembl

Aliases

HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3

Gene name

SMAD family member 3

Alternate names

mothers against decapentaplegic homolog 3, MAD homolog 3, MAD, mothers against decapentaplegic homolog 3, SMA- and MAD-related protein 3, SMAD, mothers against DPP homolog 3, hMAD-3, hSMAD3, mad homolog JV15-2, mad protein homolog, mad3, mothers against DPP homolog,

Gene location

15q22.33 (67065697: 67195194) Exons: 13 NC_000015.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq, Apr 2009]

OMIM

603109

Protein Summary

Protein general information

P84022

Name: Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD 3) (JV15 2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3)

Length: 425 Mass: 48,081

Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRL
QVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEF
PPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVT
YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMS
FVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Structural information

Protein Domains	MH1. (10-136) MH2. (232-425)
Interpro:	IPR013790 IPR003619 IPR013019 IPR017855 IPR001132 IPR008984
Prosite:	PS51075 PS51076
Pfam:	PF03165 PF03166
PDB:	1MHD 1MJS 1MK2 1OZJ 1U7F 2LAJ 2LB2
PDBsum:	1MHD 1MJS 1MK2 1OZJ 1U7F 2LAJ 2LB2
DIP:	29720
MINT:	193987
STRING:	ENSP00000332973;

Other Databases

GeneCards: SMAD3; Malacards: SMAD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000983	transcription factor acti vity, RNA polymerase II c ore promoter sequence-spe cific	IDA	molecular_function
GO:0000987	core promoter proximal re gion sequence-specific DN A binding	IDA	molecular_function
GO:0000987	core promoter proximal re gion sequence-specific DN A binding	IDA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001666	response to hypoxia	IMP	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001707	mesoderm formation	IEA	biological_process
GO:0001756	somitogenesis	IEA	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001947	heart looping	IEA	biological_process
GO:0002076	osteoblast development	IEA	biological_process
GO:0002520	immune system development	IEA	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005637	nuclear inner membrane	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006810	transport	IDA	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IMP	biological_process
GO:0006955	immune response	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008270	zinc ion binding	IDA	molecular_function
GO:0009880	embryonic pattern specifi cation	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010694	positive regulation of al kaline phosphatase activi ty	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IMP	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0016202	regulation of striated mu scle tissue development	IEA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IMP	biological_process
GO:0019049	evasion or tolerance of h ost defenses by virus	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019902	phosphatase binding	IPI	molecular_function
GO:0023019	signal transduction invol ved in regulation of gene expression	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IEA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030618	transforming growth facto r beta receptor, pathway- specific cytoplasmic medi ator activity	IDA	molecular_function
GO:0030878	thyroid gland development	IEA	biological_process
GO:0031053	primary miRNA processing	TAS	biological_process
GO:0031490	chromatin DNA binding	IEA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032332	positive regulation of ch ondrocyte differentiation	IEA	biological_process
GO:0032731	positive regulation of in terleukin-1 beta producti on	IEA	biological_process
GO:0032909	regulation of transformin g growth factor beta2 pro duction	IMP	biological_process
GO:0032916	positive regulation of tr ansforming growth factor beta3 production	IEA	biological_process
GO:0032924	activin receptor signalin g pathway	IMP	biological_process
GO:0033689	negative regulation of os teoblast proliferation	IEA	biological_process
GO:0035326	enhancer binding	IC	molecular_function
GO:0038092	nodal signaling pathway	IMP	biological_process
GO:0042060	wound healing	TAS	biological_process
GO:0042110	T cell activation	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043130	ubiquitin binding	IDA	molecular_function
GO:0043235	receptor complex	IMP	cellular_component
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045216	cell-cell junction organi zation	IMP	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048340	paraxial mesoderm morphog enesis	IEA	biological_process
GO:0048589	developmental growth	IEA	biological_process
GO:0048617	embryonic foregut morphog enesis	IEA	biological_process
GO:0048701	embryonic cranial skeleto n morphogenesis	IEA	biological_process
GO:0050678	regulation of epithelial cell proliferation	IEA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0050776	regulation of immune resp onse	IEA	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IEA	biological_process
GO:0051098	regulation of binding	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060039	pericardium development	IEA	biological_process
GO:0060290	transdifferentiation	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IEA	biological_process
GO:0061045	negative regulation of wo und healing	IEA	biological_process
GO:0070306	lens fiber cell different iation	IEA	biological_process
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0071141	SMAD protein complex	IDA	cellular_component
GO:0071141	SMAD protein complex	IDA	cellular_component
GO:0071144	SMAD2-SMAD3 protein compl ex	IDA	cellular_component
GO:0097191	extrinsic apoptotic signa ling pathway	IMP	biological_process
GO:0097296	activation of cysteine-ty pe endopeptidase activity involved in apoptotic si gnaling pathway	IEA	biological_process
GO:1901203	positive regulation of ex tracellular matrix assemb ly	IDA	biological_process
GO:0000988	transcription factor acti vity, protein binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IEA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000983	transcription factor acti vity, RNA polymerase II c ore promoter sequence-spe cific	IDA	molecular_function
GO:0000987	core promoter proximal re gion sequence-specific DN A binding	IDA	molecular_function
GO:0000987	core promoter proximal re gion sequence-specific DN A binding	IDA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001666	response to hypoxia	IMP	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001707	mesoderm formation	IEA	biological_process
GO:0001756	somitogenesis	IEA	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001947	heart looping	IEA	biological_process
GO:0002076	osteoblast development	IEA	biological_process
GO:0002520	immune system development	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IEA	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005637	nuclear inner membrane	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006810	transport	IDA	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IMP	biological_process
GO:0006955	immune response	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007183	SMAD protein complex asse mbly	IEA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007369	gastrulation	IEA	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008270	zinc ion binding	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009880	embryonic pattern specifi cation	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010694	positive regulation of al kaline phosphatase activi ty	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IMP	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0016202	regulation of striated mu scle tissue development	IEA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IEA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IMP	biological_process
GO:0019049	evasion or tolerance of h ost defenses by virus	IDA	biological_process
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019902	phosphatase binding	IPI	molecular_function
GO:0023019	signal transduction invol ved in regulation of gene expression	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IEA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030618	transforming growth facto r beta receptor, pathway- specific cytoplasmic medi ator activity	IDA	molecular_function
GO:0030878	thyroid gland development	IEA	biological_process
GO:0031053	primary miRNA processing	TAS	biological_process
GO:0031490	chromatin DNA binding	IEA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032332	positive regulation of ch ondrocyte differentiation	IEA	biological_process
GO:0032731	positive regulation of in terleukin-1 beta producti on	IEA	biological_process
GO:0032909	regulation of transformin g growth factor beta2 pro duction	IMP	biological_process
GO:0032916	positive regulation of tr ansforming growth factor beta3 production	IEA	biological_process
GO:0032924	activin receptor signalin g pathway	IMP	biological_process
GO:0033689	negative regulation of os teoblast proliferation	IEA	biological_process
GO:0035326	enhancer binding	IC	molecular_function
GO:0038092	nodal signaling pathway	IMP	biological_process
GO:0042060	wound healing	TAS	biological_process
GO:0042110	T cell activation	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043130	ubiquitin binding	IDA	molecular_function
GO:0043234	protein complex	IEA	cellular_component
GO:0043235	receptor complex	IMP	cellular_component
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045216	cell-cell junction organi zation	IMP	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0046332	SMAD binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048340	paraxial mesoderm morphog enesis	IEA	biological_process
GO:0048589	developmental growth	IEA	biological_process
GO:0048617	embryonic foregut morphog enesis	IEA	biological_process
GO:0048701	embryonic cranial skeleto n morphogenesis	IEA	biological_process
GO:0050678	regulation of epithelial cell proliferation	IEA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0050776	regulation of immune resp onse	IEA	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IEA	biological_process
GO:0051098	regulation of binding	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060039	pericardium development	IEA	biological_process
GO:0060290	transdifferentiation	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IEA	biological_process
GO:0061045	negative regulation of wo und healing	IEA	biological_process
GO:0070306	lens fiber cell different iation	IEA	biological_process
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0071141	SMAD protein complex	IDA	cellular_component
GO:0071141	SMAD protein complex	IDA	cellular_component
GO:0071144	SMAD2-SMAD3 protein compl ex	IDA	cellular_component
GO:0097191	extrinsic apoptotic signa ling pathway	IMP	biological_process
GO:0097296	activation of cysteine-ty pe endopeptidase activity involved in apoptotic si gnaling pathway	IEA	biological_process
GO:1901203	positive regulation of ex tracellular matrix assemb ly	IDA	biological_process
GO:0000988	transcription factor acti vity, protein binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000983	transcription factor acti vity, RNA polymerase II c ore promoter sequence-spe cific	IDA	molecular_function
GO:0000987	core promoter proximal re gion sequence-specific DN A binding	IDA	molecular_function
GO:0000987	core promoter proximal re gion sequence-specific DN A binding	IDA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001666	response to hypoxia	IMP	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005637	nuclear inner membrane	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006810	transport	IDA	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IMP	biological_process
GO:0006955	immune response	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008270	zinc ion binding	IDA	molecular_function
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IMP	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IMP	biological_process
GO:0019049	evasion or tolerance of h ost defenses by virus	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019902	phosphatase binding	IPI	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030618	transforming growth facto r beta receptor, pathway- specific cytoplasmic medi ator activity	IDA	molecular_function
GO:0031053	primary miRNA processing	TAS	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032909	regulation of transformin g growth factor beta2 pro duction	IMP	biological_process
GO:0032924	activin receptor signalin g pathway	IMP	biological_process
GO:0035326	enhancer binding	IC	molecular_function
GO:0038092	nodal signaling pathway	IMP	biological_process
GO:0042060	wound healing	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043130	ubiquitin binding	IDA	molecular_function
GO:0043235	receptor complex	IMP	cellular_component
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045216	cell-cell junction organi zation	IMP	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070410	co-SMAD binding	IPI	molecular_function
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0070412	R-SMAD binding	IPI	molecular_function
GO:0071141	SMAD protein complex	IDA	cellular_component
GO:0071141	SMAD protein complex	IDA	cellular_component
GO:0071144	SMAD2-SMAD3 protein compl ex	IDA	cellular_component
GO:0097191	extrinsic apoptotic signa ling pathway	IMP	biological_process
GO:1901203	positive regulation of ex tracellular matrix assemb ly	IDA	biological_process
GO:0000988	transcription factor acti vity, protein binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa05161  Hepatitis B
hsa04068  FoxO signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04659  Th17 cell differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04144  Endocytosis
hsa05142  Chagas disease
hsa04390  Hippo signaling pathway
hsa05321  Inflammatory bowel disease
hsa04110  Cell cycle
hsa04371  Apelin signaling pathway
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa05210  Colorectal cancer
hsa04350  TGF-beta signaling pathway
hsa04520  Adherens junction
hsa04310  Wnt signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 18780302
Asthma	PMID: 20860503
Cancer	PMID: 19351817
Crohn's disease	PMID: 21102463
Diabetes	PMID: 19247629
Endometriosis	PMID: 25228630
Hypertension	PMID: 19211612
Loeys-Dietz syndrome	KEGG: H00800, OMIM: 603109
Endometriosis	INFBASE25228630

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25228630	Endometrio sis			27 (15 women wi th endometriosi s, 15 women wit hout endometrio sis)		Nodal Cripto SMAD3 SMAD4	Show abstract