Endometriosis Knowledgebase

Search Result

Gene id

412

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

STS Gene UCSC Ensembl

Aliases

ARSC, ARSC1, ASC, ES, SSDD, XLI

Gene name

steroid sulfatase

Alternate names

steryl-sulfatase, arylsulfatase C, estrone sulfatase, steroid sulfatase (microsomal), isozyme S, steryl-sulfate sulfohydrolase,

Gene location

Xp22.31 (7147251: 7354642) Exons: 16 NC_000023.11

Gene summary(Entrez)

This gene encodes a multi-pass membrane protein that is localized to the endoplasmic reticulum. It belongs to the sulfatase family and hydrolyzes several 3-beta-hydroxysteroid sulfates, which serve as metabolic precursors for estrogens, androgens, and cholesterol. Mutations in this gene are associated with X-linked ichthyosis (XLI). Alternatively spliced transcript variants resulting from the use of different promoters have been described for this gene (PMID:17601726). [provided by RefSeq, Mar 2016]

OMIM

300747

Protein Summary

Protein general information

P08842

Name: Steryl sulfatase (EC 3.1.6.2) (Arylsulfatase C) (ASC) (Steroid sulfatase) (Steryl sulfate sulfohydrolase)

Length: 583 Mass: 65,492

Sequence

MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPLC
TPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMSCHSKTDFCHH
PLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAAL
ILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFA
GKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGG
IRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHYCNAYL
NAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYE
ILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR

Structural information

Interpro:	IPR017849 IPR017850 IPR024607 IPR000917
Prosite:	PS00523 PS00149
Pfam:	PF00884
PDB:	1P49
PDBsum:	1P49
MINT:	1177440
STRING:	ENSP00000217961;

Other Databases

GeneCards: STS; Malacards: STS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004773	steryl-sulfatase activity	TAS	molecular_function
GO:0005635	nuclear envelope	IEA	cellular_component
GO:0005764	lysosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005783	endoplasmic reticulum	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006687	glycosphingolipid metabol ic process	TAS	biological_process
GO:0006706	steroid catabolic process	TAS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008484	sulfuric ester hydrolase activity	IDA	molecular_function
GO:0008544	epidermis development	TAS	biological_process
GO:0009268	response to pH	IEA	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	TAS	cellular_component
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043588	skin development	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043687	post-translational protei n modification	TAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0003824	catalytic activity	IEA	molecular_function
GO:0004773	steryl-sulfatase activity	IEA	molecular_function
GO:0004773	steryl-sulfatase activity	IEA	molecular_function
GO:0004773	steryl-sulfatase activity	TAS	molecular_function
GO:0004773	steryl-sulfatase activity	TAS	molecular_function
GO:0005635	nuclear envelope	IEA	cellular_component
GO:0005764	lysosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006687	glycosphingolipid metabol ic process	TAS	biological_process
GO:0006706	steroid catabolic process	TAS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0008152	metabolic process	IEA	biological_process
GO:0008202	steroid metabolic process	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular_function
GO:0008484	sulfuric ester hydrolase activity	IDA	molecular_function
GO:0008544	epidermis development	TAS	biological_process
GO:0009268	response to pH	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	TAS	cellular_component
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043588	skin development	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043687	post-translational protei n modification	TAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0004773	steryl-sulfatase activity	TAS	molecular_function
GO:0004773	steryl-sulfatase activity	TAS	molecular_function
GO:0005764	lysosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005783	endoplasmic reticulum	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006687	glycosphingolipid metabol ic process	TAS	biological_process
GO:0006706	steroid catabolic process	TAS	biological_process
GO:0008484	sulfuric ester hydrolase activity	IDA	molecular_function
GO:0008544	epidermis development	TAS	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	TAS	cellular_component
GO:0043687	post-translational protei n modification	TAS	biological_process

KEGG pathways

hsa00140 Steroid hormone biosynthesis
hsa00140 Steroid hormone biosynthesis

Diseases

Associated diseases	References
Endometrial cancer	PMID: 18450955
Endometriosis	PMID: 16084891
Ichthyosis	KEGG: H00134, OMIM: 300747
Female infertility	INFBASE16084891
Endometriosis	INFBASE16084891
Polycystic ovary syndrome (PCOS)	PMID: 17426092
Ichthyosis, X-linked	OMIM300747
X-linked ichthyosis	KEGGH00134

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
24012197	Endometrio sis	120 (41 disease - free patients , 79 patients w ith endometrios is)			Show abstract
16084891	Endometrio sis	67 (35 cases co mplicated by en dometriosis, 16 PCOS cases, 16 cases of laten t hyperprolacti nemia )	Female infertility	STS	Show abstract
17454161	Endometrio sis	25 (16 samples of ovarian endo metriosis, 9 of normal endomet rium)		Aromatase 17beta-HSD types 1 17beta-HSD types 7 sulfatase Erbeta Eralpha	Show abstract