Endometriosis Knowledgebase

Search Result

Gene id

4192

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MDK Gene UCSC Ensembl

Aliases

ARAP, MK, NEGF2

Gene name

midkine

Alternate names

midkine, amphiregulin-associated protein, midgestation and kidney protein, neurite growth-promoting factor 2, neurite outgrowth-promoting factor 2, retinoic acid inducible factor,

Gene location

11p11.2 (46380783: 46383836) Exons: 6 NC_000011.10

Gene summary(Entrez)

This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

OMIM

162096

Protein Summary

Protein general information

P21741

Name: Midkine (MK) (Amphiregulin-associated protein) (ARAP) (Midgestation and kidney protein) (Neurite outgrowth-promoting factor 2) (Neurite outgrowth-promoting protein)

Length: 143 Mass: 15,585

Tissue specificity: Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions. {ECO

Sequence

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCN
WKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Structural information

Interpro:	IPR000762 IPR020090 IPR038130 IPR020091 IPR020089 IPR037122 IPR020092
Prosite:	PS00619 PS00620
Pfam:	PF01091 PF05196
PDB:	1MKC 1MKN
PDBsum:	1MKC 1MKN
DIP:	5789
MINT:
STRING:	ENSP00000352852;

Other Databases

GeneCards: MDK; Malacards: MDK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001662	behavioral fear response	IEA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0007614	short-term memory	IEA	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0009611	response to wounding	ISS	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0021542	dentate gyrus development	IEA	biological_process
GO:0021681	cerebellar granular layer development	IEA	biological_process
GO:0021987	cerebral cortex developme nt	IEA	biological_process
GO:0030154	cell differentiation	NAS	biological_process
GO:0030325	adrenal gland development	ISS	biological_process
GO:0030421	defecation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0050795	regulation of behavior	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0001662	behavioral fear response	IEA	biological_process
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0007614	short-term memory	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0009611	response to wounding	IEA	biological_process
GO:0009611	response to wounding	ISS	biological_process
GO:0009725	response to hormone	IEA	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0021542	dentate gyrus development	IEA	biological_process
GO:0021681	cerebellar granular layer development	IEA	biological_process
GO:0021766	hippocampus development	IEA	biological_process
GO:0021987	cerebral cortex developme nt	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030154	cell differentiation	NAS	biological_process
GO:0030325	adrenal gland development	IEA	biological_process
GO:0030325	adrenal gland development	ISS	biological_process
GO:0030421	defecation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0050795	regulation of behavior	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0009611	response to wounding	ISS	biological_process
GO:0030154	cell differentiation	NAS	biological_process
GO:0030325	adrenal gland development	ISS	biological_process

Diseases

Associated diseases	References
Endometriosis	INFBASE11912283
Mesomelic dysplasia, Kantaputra type	OMIM156232

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11912283	Endometrio sis			60 (30 women wi th severe, stag es III and IV e ndometriosis, 3 0 women without endometriosis)			Show abstract