Endometriosis Knowledgebase

Search Result

Gene id

4211

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MEIS1 Gene UCSC Ensembl

Gene name

Meis homeobox 1

Alternate names

homeobox protein Meis1, Meis1, myeloid ecotropic viral integration site 1 homolog, WUGSC:H_NH0444B04.1, leukemogenic homolog protein,

Gene location

2p14 (66435124: 66572764) Exons: 15 NC_000002.12

Gene summary(Entrez)

Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. [provided by RefSeq, Jul 2008]

OMIM

601739

Protein Summary

Protein general information

O00470

Name: Homeobox protein Meis1

Length: 390 Mass: 43,016

Tissue specificity: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also ex

Sequence

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDK
DAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQ
VLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRS
GGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMS
GMGMNMGMEGQWHYM

Structural information

Interpro:	IPR009057 IPR001356 IPR008422 IPR032453
Prosite:	PS50071
Pfam:	PF05920 PF16493
PDB:	4XRS 5EGO
PDBsum:	4XRS 5EGO
STRING:	ENSP00000272369;

Other Databases

GeneCards: MEIS1; Malacards: MEIS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0002089	lens morphogenesis in cam era-type eye	IEA	biological_process
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007626	locomotory behavior	IEA	biological_process
GO:0035855	megakaryocyte development	IEA	biological_process
GO:0045638	negative regulation of my eloid cell differentiatio n	ISS	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0060216	definitive hemopoiesis	IEA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0002089	lens morphogenesis in cam era-type eye	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007626	locomotory behavior	IEA	biological_process
GO:0030097	hemopoiesis	IEA	biological_process
GO:0035855	megakaryocyte development	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0045638	negative regulation of my eloid cell differentiatio n	IEA	biological_process
GO:0045638	negative regulation of my eloid cell differentiatio n	ISS	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048514	blood vessel morphogenesi s	IEA	biological_process
GO:0060216	definitive hemopoiesis	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0045638	negative regulation of my eloid cell differentiatio n	ISS	biological_process

KEGG pathways

hsa05202 Transcriptional misregulation in cancer
hsa04550 Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Celiac disease	PMID: 19240061
Endometriosis	PMID: 24985084
Implantation failure	PMID: 24985084
Implantation defects	INFBASE24985084
Endometriosis	INFBASE24985084
Restless legs syndrome	PMID: 19279021

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24985084	Endometrio sis						Show abstract