Endometriosis Knowledgebase

Search Result

Gene id

4233

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MET Gene UCSC Ensembl

Aliases

AUTS9, DFNB97, HGFR, RCCP2, c-Met

Gene name

MET proto-oncogene, receptor tyrosine kinase

Alternate names

hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, SF receptor, proto-oncogene c-Met, scatter factor receptor, tyrosine-protein kinase Met,

Gene location

7q31.2 (116672358: 116798385) Exons: 24 NC_000007.14

Gene summary(Entrez)

This gene encodes a member of the receptor tyrosine kinase family of proteins and the product of the proto-oncogene MET. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that are linked via disulfide bonds to form the mature receptor. Further processing of the beta subunit results in the formation of the M10 peptide, which has been shown to reduce lung fibrosis. Binding of its ligand, hepatocyte growth factor, induces dimerization and activation of the receptor, which plays a role in cellular survival, embryogenesis, and cellular migration and invasion. Mutations in this gene are associated with papillary renal cell carcinoma, hepatocellular carcinoma, and various head and neck cancers. Amplification and overexpression of this gene are also associated with multiple human cancers. [provided by RefSeq, May 2016]

OMIM

164860

Protein Summary

Protein general information

P08581

Name: Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto oncogene c Met) (Scatter factor receptor) (SF receptor) (Tyrosine protein kinase Met)

Length: 1390 Mass: 155,541

Tissue specificity: Expressed in normal hepatocytes as well as in epithelial cells lining the stomach, the small and the large intestine. Found also in basal keratinocytes of esophagus and skin. High levels are found in liver, gastrointestinal tract, thyr

Sequence

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNE
EDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNH
TADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDG
FMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFN
KIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDL
TIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQS
CSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLL
TLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPT
KSFISGGSTITGVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDG
ILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARV
HTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFL
TEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWE
LMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYV
HVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS

Structural information

Protein Domains	Sema. (27-515) IPT/TIG (563-655) IPT/TIG (657-739) IPT/TIG (742-836) Protein (1078-1345)
Interpro:	IPR013783 IPR014756 IPR002909 IPR011009 IPR002165 IPR000719 IPR017441 IPR016201 IPR001627 IPR001245 IPR008266 IPR020635 IPR016244 IPR015943
Prosite:	PS00107 PS50011 PS00109 PS51004
Pfam:	PF07714 PF01437 PF01403 PF01833
PDB:	1FYR 1R0P 1R1W 1SHY 1SSL 1UX3 2G15 2RFN 2RFS 2UZX 2UZY 2WD1 2WGJ 2WKM 3A4P 3BUX 3C1X 3CCN 3CD8 3CE3 3CTH 3CTJ 3DKC 3DKF 3DKG 3EFJ 3EFK 3F66 3F82 3I5N 3L8V 3LQ8 3Q6U 3Q6W 3QTI 3R7O 3RHK 3U6H 3U6I 3VW8 3ZBX 3ZC5 3ZCL 3ZXZ 3ZZE 4AOI 4AP7 4DEG 4DEH 4DEI 4EEV
PDBsum:	1FYR 1R0P 1R1W 1SHY 1SSL 1UX3 2G15 2RFN 2RFS 2UZX 2UZY 2WD1 2WGJ 2WKM 3A4P 3BUX 3C1X 3CCN 3CD8 3CE3 3CTH 3CTJ 3DKC 3DKF 3DKG 3EFJ 3EFK 3F66 3F82 3I5N 3L8V 3LQ8 3Q6U 3Q6W 3QTI 3R7O 3RHK 3U6H 3U6I 3VW8 3ZBX 3ZC5 3ZCL 3ZXZ 3ZZE 4AOI 4AP7 4DEG 4DEH 4DEI 4EEV
DIP:	6023
MINT:	4837114
STRING:	ENSP00000317272;

Other Databases

GeneCards: MET; Malacards: MET

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001886	endothelial cell morphoge nesis	IDA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	NAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005008	hepatocyte growth factor- activated receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	NAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0009925	basal plasma membrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010507	negative regulation of au tophagy	NAS	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	IEA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IMP	biological_process
GO:0050918	positive chemotaxis	IDA	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	IDA	biological_process
GO:1901299	negative regulation of hy drogen peroxide-mediated programmed cell death	IMP	biological_process
GO:2001028	positive regulation of en dothelial cell chemotaxis	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001886	endothelial cell morphoge nesis	IDA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	NAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0005008	hepatocyte growth factor- activated receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	NAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0009925	basal plasma membrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010507	negative regulation of au tophagy	NAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	IEA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IMP	biological_process
GO:0050918	positive chemotaxis	IDA	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	IDA	biological_process
GO:1901299	negative regulation of hy drogen peroxide-mediated programmed cell death	IMP	biological_process
GO:2001028	positive regulation of en dothelial cell chemotaxis	IMP	biological_process
GO:0001886	endothelial cell morphoge nesis	IDA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	NAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005008	hepatocyte growth factor- activated receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	NAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0009925	basal plasma membrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010507	negative regulation of au tophagy	NAS	biological_process
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IMP	biological_process
GO:0050918	positive chemotaxis	IDA	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	IDA	biological_process
GO:1901299	negative regulation of hy drogen peroxide-mediated programmed cell death	IMP	biological_process
GO:2001028	positive regulation of en dothelial cell chemotaxis	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa05202  Transcriptional misregulation in cancer
hsa04144  Endocytosis
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04360  Axon guidance
hsa05218  Melanoma
hsa05230  Central carbon metabolism in cancer
hsa04520  Adherens junction
hsa05144  Malaria
hsa05211  Renal cell carcinoma
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Autism	PMID: 17053076
Cholangiocarcinoma	KEGG: H00046
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Deafness	OMIM: 164860
Diabetes	PMID: 12646233
Endometriosis	PMID: 23670619
Gastric cancer	KEGG: H00018
Hepatocellular carcinoma	OMIM: 164860
Multiple sclerosis	PMID: 19010793
Myopia	PMID: 19471602
Osteofibrous dysplasia	OMIM: 164860
Pelvic endometriosis	PMID: 12524084
Endometriosis	INFBASE23670619
Endometriosis	INFBASE15201072
Pelvic endometriosis	INFBASE12524084
Polycystic ovary syndrome (PCOS)	PMID: 23036804
Renal cell carcinoma	KEGG: H00021, OMIM: 164860

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
15201072	Endometrio sis	78 (54 women in reproductive a ge with endomet riosis confirme d by laparoscop y and histologi cal examination (including 28 cases of stages I/II and 26 of stages III/IV) , 24 endometr ium of healthy fertile women)		c-met HGF	Show abstract
12524084	Endometrio sis (Pelvi c)	25 (15 infertil e women with pe lvic endometrio sis, 10 v)		HGF c-Met	Show abstract
23670619	Endometrio sis	18 ( 9 eutopic endometrial cel ls collected fr om females with endometriosis, 9 eutopic endo metrial cells c ollected from f emales without endometriosis)	Female infertility	CXCR4 SOX2 MET CRMP2 Oct4	Show abstract