Endometriosis Knowledgebase

Search Result

Gene id

4313

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP2 Gene UCSC Ensembl

Aliases

CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1

Gene name

matrix metallopeptidase 2

Alternate names

72 kDa type IV collagenase, collagenase type IV-A, matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase), matrix metalloproteinase-2, matrix metalloproteinase-II, neutrophil gelatinase,

Gene location

16q12.2 (55478829: 55506690) Exons: 17 NC_000016.10

Gene summary(Entrez)

This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

OMIM

120360

SNPs

rs2285053

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000678.2   g.55478465C>T
NC_000016.10   g.55478465C>T
NC_000016.9   g.55512377C>T
NG_008989.1   g.4297C>T
NM_001302508.1   c.-576C>T
NM_001302510.1   c.-1666C>T
NM_004530.5   c.-1015C>T
rs243847

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000678.2   g.55490086T>C
NC_000016.10   g.55490086T>C
NC_000016.9   g.55523998T>C
NG_008989.1   g.15918T>C
NM_001127891.2   c.1030+262T>C
NM_001302508.1   c.952+262T>C
NM_001302509.1   c.952+262T>C
NM_001302510.1   c.952+262T>C
NM_004530.5   c.1180+262T>C
rs243865

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000678.2   g.55477894C>T
NC_000016.10   g.55477894C>T
NC_000016.9   g.55511806C>T
NG_008989.1   g.3726C>T
NM_001302508.1   c.-1147C>T
NM_004530.5   c.-1586C>T
Clinical Significance: other

Protein Summary

Protein general information

P08253

Name: 72 kDa type IV collagenase (EC 3.4.24.24) (72 kDa gelatinase) (Gelatinase A) (Matrix metalloproteinase 2) (MMP 2) (TBE 1) [Cleaved into: PEX]

Length: 660 Mass: 73,882

Tissue specificity: Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate. {ECO

Sequence

MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLK
KMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQV
WSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKY
GNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWC
ATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPD
IDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYE
APQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Structural information

Protein Domains	Fibronectin (228-276) Fibronectin (286-334) Fibronectin (344-392)
Motifs	Cysteine switch.(100-107)
Interpro:	IPR028708 IPR000562 IPR000585 IPR018487 IPR018486 IPR013806 IPR033739 IPR024079 IPR001818 IPR021190 IPR021158 IPR006026 IPR002477
Prosite:	PS00546 PS00023 PS51092 PS00024 PS51642 PS00142
Pfam:	PF00040 PF00045 PF00413 PF01471
CDD:	cd00062 cd00094 cd04278
PDB:	1CK7 1CXW 1EAK 1GEN 1GXD 1HOV 1J7M 1KS0 1QIB 1RTG 3AYU
PDBsum:	1CK7 1CXW 1EAK 1GEN 1GXD 1HOV 1J7M 1KS0 1QIB 1RTG 3AYU
STRING:	ENSP00000219070;

Other Databases

GeneCards: MMP2; Malacards: MMP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001955	blood vessel maturation	IEA	biological_process
GO:0001957	intramembranous ossificat ion	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030017	sarcomere	IEA	cellular_component
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045089	positive regulation of in nate immune response	IEA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0060325	face morphogenesis	IEA	biological_process
GO:0060346	bone trabecula formation	IEA	biological_process
GO:0071230	cellular response to amin o acid stimulus	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001955	blood vessel maturation	IEA	biological_process
GO:0001957	intramembranous ossificat ion	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030017	sarcomere	IEA	cellular_component
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045089	positive regulation of in nate immune response	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048705	skeletal system morphogen esis	IEA	biological_process
GO:0060325	face morphogenesis	IEA	biological_process
GO:0060346	bone trabecula formation	IEA	biological_process
GO:0071230	cellular response to amin o acid stimulus	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa01522  Endocrine resistance
hsa04915  Estrogen signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa05219  Bladder cancer
hsa04912  GnRH signaling pathway

Diseases

Associated diseases	References
Adenomyosis	PMID: 19188819
Adenomyosis	PMID: 18288718
Alzheimer's disease	PMID: 19141999
Aortic aneurysm	PMID: 15944607
Arthritis	PMID: 11981324
Azoospermia	PMID: 12407049
Bowel endometriosis	PMID: 15452706
Choriocarcinoma	KEGG: H00028
Chronic endometritis	PMID: 16984109
Chronic kidney failure	PMID: 19578796
Congenital bilateral absence of the vas deferens (CBAVD)	PMID: 19092444
Connective tissue diseases	PMID: 19527514
Crohn's disease	PMID: 17589947
Diabetes	PMID: 19360430
Diabetic retinopathy	PMID: 18552985
Endometriosis	PMID: 22056701
Female infertility	PMID: 23054355
Hyperandrogenism	PMID: 24693338
Idiopathic male infertility	PMID: 26181468
Impaired reproduction	PMID: 18292822
Implantation failure	PMID: 12615834
Leiomyoma	PMID: 14597251
Multiple sclerosis	PMID: 18563468
Osteoarthritis	PMID: 12939660
Ovarian endometriosis	PMID: 15005245
Pelvic endometriosis	PMID: 23171686
Periodontitis	PMID: 16018746
Peritoneal endometriosis	PMID: 15452706
Peritoneal endometriosis	PMID: 17465288
Implantation failure	INFBASE23979130
Endometriosis associated infertility	INFBASE23979130
Pelvic endometriosis	INFBASE23171686
Endometriosis (Pelvic)	INFBASE23171686
Implantation defects	INFBASE23011643
Endometrial carcinoma	INFBASE18295959
Peritoneal, rectovaginal and�ovarian�endometriosis	INFBASE17465288
Adenomyosis	INFBASE16468658
Peritoneal, ovarian and bowel endometriotic tissues	INFBASE15452706
Ovarian endometriosis	INFBASE15005245
Endometriosis	INFBASE11949944
Uterine endometriosis	INFBASE9623791
Polycystic ovary syndrome (PCOS)	PMID: 16338908
Psoriasis	PMID: 12077518
Rectovaginal endometriosis	PMID: 17465288
Recurrent implantation failure (RIF)	PMID: 12615834
Rheumatoid arthritis	PMID: 16356191
Rhinitis	PMID: 18711060
Torg-Winchester syndrome	KEGG: H00472
Unexplained infertility	PMID: 19778485
Unexplained infertility	PMID: 12468644
Uterine endometriosis	PMID: 9623791
Uterine endometriosis	PMID: 9623791

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11949944	Endometrio sis					MMP	Show abstract
15005245	Endometrio sis (ovari an)					FCER1G PGDS IL-8 GRO1 GRO2 CXCR4 MCP1 MMP COL4A2 and COL5A2	Show abstract
19055724	Endometrio sis			4 (3 endometrio tic tissues, 1 normal tissue)		MMP1 MMP2 MMP3 MMP10 MMP11 MMP14 IGF2 ACTN4 AXL and SHC1	Show abstract
21111772	Endometrio sis				Female infertility	PGE2 COX-2 MMP1 MMP2 MMP3 MMP7 MMP9 TIMP1 TIMP2 TIMP3 TIMP4	Show abstract
23364396	Endometrio sis	rs7201	Chinese	555 (211 patien ts, 344 control s)			Show abstract
22056701	Endometrio sis			97		MMP2 MMP9 PCNA	Show abstract
18584412	Endometrio sis			37 (15 mild end ometriosis, 22 severe endometr iosis)		MMP-2 MMP-9 TIMP-1 and TIMP-2	Show abstract
15136083	Endometrio sis			58 (40 patients with endometri osis-associated infertility un dergoing laparo scopy, 18 women undergoing tub al ligation)	Female infertility		Show abstract
18295959	Endometrio sis			40 (15 endometr iotic tissue, 1 5 low-grade end ometrial endome trioid carcinom as, 10 unremark able proliferat ive endometrium from women wit hout endometrio sis or carcinom a)		MMP-2 MMP-9 E-cadherin and beta-catenin	Show abstract
12587534	Endometrio sis			47 (35 women wi th endometriosi s, 12 women wit hout endometrio sis)		MMP-2 MMP-9 MT1-MMP	Show abstract
22985025	Endometrio sis	MMP-2 (9082A>G, 9152A>G, 105330C>T, 14931T>C, 15918T>C, 18796G>A, 19033G>A, 19218A>G, 25190A>G, and 28542C>T) and TMIP-2 gene (42138327C>T, 42141169G>A, 42144611A>G, 42152781C>T, 42155855G>A, 42175617C>T, 42181597G>A, 42183387T>C, 42196041G>C, and 4219643		384 (201 patien ts, 183 control s)		MMP-2 TIMP-2	Show abstract
20100617	Endometrio sis	MMP-2 (-735 C/T), MMP-9 (-1562 C/T)	Caucasi an			MMP-2 MMP-9	Show abstract
18644593	Endometrio sis			60 (30 women wi th endometriosi s, 30 endometri um biopsy sampl es from 30 heal thy women)		ANGPT1 ANGPT2 MMP-1 MMP-2 MMP-9 VEGF	Show abstract
18543216	Endometrio sis	MMP-2 -1306C/T, MMP-2 -735C/T and TIMP-2 -418G/C		802 (298 endome triosis patient s, 180 adenomyo sis patients an d 324 matched c ontrol women)		MMP-2 TIMP-2	Show abstract
18177649	Endometrio sis	MMP-2 (-1306C-->T, -735C-->T), TIMP-2 (-418G-->C)	Chinese			MMP-2 TIMP-2	Show abstract
12372458	Endometrio sis	MMP-2, MT1-MMP, TIMP-2		53 (23 with end ometriosis and 30 without endo metriosis)		MMP-2 MT1-MMP TIMP-2	Show abstract
12107265	Endometrio sis			47 (35 women wi th endometriosi s, 12 women wit hout endometrio sis)		MMP-2 MMP-9 MT1-MMP survivin	Show abstract
20378112	Endometrio sis					MMP-9 MMP-2 MMP-9/neutrophil gelatinase-associated lipocalin	Show abstract
16468658	Endometrio sis					MMP-2 MMP-3 TIMP-2	Show abstract
23979130	Endometrio sisEndomet riosis ass ociated in fertility			57 (31 infertil e women with en dometriosis, 26 infertile wome n without endom etriosis)	Female infertility	HOXA-10 HOXA-11 MMP-2 MMP-9 integrin LIF	Show abstract
23011643	Endometrio sis			265 (194 patien ts affected by endometriosis, 71 patients wit h normal endome trium)		MMP-2 MT1-MMP TIMP-2	Show abstract
23171686	Endometrio sis (Pelvi c)			30 (10 stage I/ II endometriosi s, 10 stage III /IV endometrios is, 10 control s (infertility due to tubal an d/or male facto r)			Show abstract
15452706	Endometrio sis (perit oneal, ova rian, bowe l)			87 (9 women wit h endometriosis , 18 women with out endometrios is, 20 with per itoneal endomet riosis, 20 ovar ian endometrios is, 20 colorect al endometriosi s)		MMP-2	Show abstract
17465288	Endometrio sis (perit oneal, rec tovaginal, ovarian)			62 (Twenty-nine peritoneal end ometriosis lesi ons (9 red, 12 black and 8 whi te), 11 rectova ginal and 22 ov arian)		CD44 VEGF and MMP-2	Show abstract
9623791	Endometrio sis (Uteri ne)			61 (32 endometr iotic tissues, 18 uterine endo metria of patie nts with endome triosis, 11 nor mal-menstruatin g women without endometriosis)	Female infertility	MMP-2	Show abstract
27620811	Endometrio sis	MMP1 (-1607 1G>2G polymorphism), MMP-2 (15918 T>C, -753 C>T), MMP7 (-181 A>G), MMP9 (-1562 C>T, R279Q)	English , Chine se	4023 (1833 pati ents, 2190 cont rols)		MMP9 MMP7 MMP2 MMP1	Show abstract