Endometriosis Knowledgebase

Search Result

Gene id

4314

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP3 Gene UCSC Ensembl

Aliases

CHDS6, MMP-3, SL-1, STMY, STMY1, STR1

Gene name

matrix metallopeptidase 3

Alternate names

stromelysin-1, matrix metalloproteinase 3 (stromelysin 1, progelatinase), proteoglycanase, transin-1,

Gene location

11q22.2 (102843688: 102835796) Exons: 10 NC_000011.10

Gene summary(Entrez)

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008]

OMIM

185250

Protein Summary

Protein general information

P08254

Name: Stromelysin 1 (SL 1) (EC 3.4.24.17) (Matrix metalloproteinase 3) (MMP 3) (Transin 1)

Length: 477 Mass: 53,977

Sequence

MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEV
TGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFS
RLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLG
LFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRG
IHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFF
TGSSQLEFDPNAKKVTHTLKSNSWLNC

Structural information

Motifs	Cysteine switch.(90-97)
Interpro:	IPR000585 IPR018487 IPR018486 IPR033739 IPR024079 IPR001818 IPR021190 IPR016293 IPR021158 IPR006026 IPR002477 IPR028700
Prosite:	PS00546 PS00024 PS51642 PS00142
Pfam:	PF00045 PF00413 PF01471
CDD:	cd00094 cd04278
PDB:	1B3D 1B8Y 1BIW 1BM6 1BQO 1C3I 1C8T 1CAQ 1CIZ 1CQR 1D5J 1D7X 1D8F 1D8M 1G05 1G49 1G4K 1HFS 1HY7 1M1W 1OO9 1QIA 1QIC 1SLM 1SLN 1UEA 1UMS 1UMT 1USN 2D1O 2JNP 2JT5 2JT6 2SRT 2USN 3OHL 3OHO 3USN 4DPE 4G9L 4JA1
PDBsum:	1B3D 1B8Y 1BIW 1BM6 1BQO 1C3I 1C8T 1CAQ 1CIZ 1CQR 1D5J 1D7X 1D8F 1D8M 1G05 1G49 1G4K 1HFS 1HY7 1M1W 1OO9 1QIA 1QIC 1SLM 1SLN 1UEA 1UMS 1UMT 1USN 2D1O 2JNP 2JT5 2JT6 2SRT 2USN 3OHL 3OHO 3USN 4DPE 4G9L 4JA1
MINT:	269333
STRING:	ENSP00000299855;

Other Databases

GeneCards: MMP3; Malacards: MMP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010727	negative regulation of hy drogen peroxide metabolic process	IDA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0032461	positive regulation of pr otein oligomerization	IDA	biological_process
GO:0071732	cellular response to nitr ic oxide	TAS	biological_process
GO:1903209	positive regulation of ox idative stress-induced ce ll death	ISS	biological_process
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010727	negative regulation of hy drogen peroxide metabolic process	IDA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0032461	positive regulation of pr otein oligomerization	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0071732	cellular response to nitr ic oxide	TAS	biological_process
GO:1903209	positive regulation of ox idative stress-induced ce ll death	ISS	biological_process
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0010727	negative regulation of hy drogen peroxide metabolic process	IDA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0032461	positive regulation of pr otein oligomerization	IDA	biological_process
GO:0071732	cellular response to nitr ic oxide	TAS	biological_process
GO:1903209	positive regulation of ox idative stress-induced ce ll death	ISS	biological_process

KEGG pathways

hsa05202  Transcriptional misregulation in cancer
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa05323  Rheumatoid arthritis
PTHR10201:SF215  CCKR signaling map

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 15337261
Amyotrophic lateral sclerosis (ALS)	PMID: 18513389
Aneurysm	PMID: 15308783
Ankylosing spondylitis	PMID: 15546966
Arthritis	PMID: 12124858
Bowel endometriosis	PMID: 15452706
Cancer	PMID: 19789190
Celiac disease	PMID: 12229968
Cerebral palsy	PMID: 19238444
Cholangitis	PMID: 11438501
Chronic kidney failure	PMID: 19578796
Cleft lip	PMID: 17537400
Connective tissue diseases	PMID: 19527514
Crohn's disease	PMID: 17589947
Diabetes	PMID: 19479237
Endometriosis	PMID: 11301163
Genital endometriosis	PMID: 25711032
Metabolic syndrome	PMID: 19056482
Migraine disorders	PMID: 19559392
Mucocutaneous lymph node syndrome	PMID: 18810583
Multiple sclerosis	PMID: 19628284
Myopia	PMID: 16935611
Ovarian endometriosis	PMID: 15452706
Periodontitis	PMID: 15312099
Peritoneal endometriosis	PMID: 15452706
Genital endometriosis	INFBASE25711032
Adenomyosis	INFBASE16468658
Peritoneal, ovarian and bowel endometriotic tissues	INFBASE15452706
Endometriosis	INFBASE11301163
Preeclampsia	PMID: 17137622
Primary sclerosing cholangitis	PMID: 11438501
Restenosis	PMID: 11977998
Rheumatoid arthritis	PMID: 16356191
Schizophrenia	PMID: 19245826
Spinal diseases	PMID: 18469698
Ulcerative colitis	PMID: 12572877

PubMed references

PMID	Condition	Mutation	Population details	Infertility_type	Associated_genes	Abstract
27041028	Endometrio sis		106 (62 control s, 44 endometri osis)		Rac1 MMP3 ATF-2 SDC4	Show abstract
19055724	Endometrio sis		4 (3 endometrio tic tissues, 1 normal tissue)		MMP1 MMP2 MMP3 MMP10 MMP11 MMP14 IGF2 ACTN4 AXL and SHC1	Show abstract
21111772	Endometrio sis			Female infertility	PGE2 COX-2 MMP1 MMP2 MMP3 MMP7 MMP9 TIMP1 TIMP2 TIMP3 TIMP4	Show abstract
19200988	Endometrio sis		28 (17 patients in whom endome triosis, 11 hea lthy fertile wo men)		MMP3	Show abstract
15879464	Endometrio sis	MMP1 promoter SNP, MMP 2G/6A, MMP3 promoter SNP	250 (100 women with endometrio sis, 150 contro l subjects)		MMP1 MMP3	Show abstract
25711032	Endometrio sis (Genit al)	MMP3 (rs3025058), MMP7 (rs11568818), MMP9 (rs17576, rs2250889), MMP12 (rs2276109), and MMP13 (rs2252070)			MMP3 MMP7 MMP9 MMP12 MMP13	Show abstract
17609243	Endometrio sis		121 (71 women w ith endometrios is, 50 controls )		VEGF uPA and MMP-3	Show abstract
15579491	Endometrio sis		89 (57 women wi th endometriosi s, 32 controls)			Show abstract
12832381	Endometrio sis		74 (39 women wi th endometriosi s, 35 controls)		uPA PAI-1 MMP-3 TIMP-1	Show abstract
21150162	Endometrio sis		60 (20 patients with mild/inte rmediate endome triosis, 20 pat ients with seve re endometriosi s, 20 endometri osis-free subje cts)		MMP-3 VEGFA MMP-9	Show abstract
11301163	Endometrio sis		51 (19 regularl y cycling women , 32 without en dometriosis)		MMP-3 IL-1 TIMP-1 TIMP-2 MMP 1 MMP 2 MMP 9	Show abstract
16468658	Endometrio sis				MMP-2 MMP-3 TIMP-2	Show abstract
15452706	Endometrio sis (perit oneal, ova rian, bowe l)		87 (9 women wit h endometriosis , 18 women with out endometrios is, 20 with per itoneal endomet riosis, 20 ovar ian endometrios is, 20 colorect al endometriosi s)		MMP-2 MMP-3 MMP-11 TIMP-1 and TIMP-2	Show abstract