Endometriosis Knowledgebase

Search Result

Gene id

4316

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP7 Gene UCSC Ensembl

Aliases

MMP-7, MPSL1, PUMP-1

Gene name

matrix metallopeptidase 7

Alternate names

matrilysin, matrin, matrix metallopeptidase 7 (matrilysin, uterine), matrix metalloproteinase 7 (matrilysin, uterine), matrix metalloproteinase-7, pump-1 protease, uterine matrilysin, uterine metalloproteinase,

Gene location

11q22.2 (102530752: 102520507) Exons: 6 NC_000011.10

Gene summary(Entrez)

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal hemopexin domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes on chromosome 11. This gene exhibits elevated expression levels in multiple human cancers. [provided by RefSeq, Jan 2016]

OMIM

178990

SNPs

rs11568818

Strand:    Allele origin:   Allele change: A/G/T   Mutation type: snp

CM000673.2   g.102530930T>A
CM000673.2   g.102530930T>C
NC_000011.10   g.102530930T>A
NC_000011.10   g.102530930T>C
NC_000011.9   g.102401661T>C
NM_002423.4   c.-230A>G
NM_002423.4   c.-230A>T

Protein Summary

Protein general information

P09237

Name: Matrilysin (EC 3.4.24.23) (Matrin) (Matrix metalloproteinase 7) (MMP 7) (Pump 1 protease) (Uterine metalloproteinase)

Length: 267 Mass: 29,677

Sequence

MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLN
SRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG
TADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHS
SDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

Structural information

Motifs	Cysteine switch.(85-92)
Interpro:	IPR033739 IPR028707 IPR024079 IPR001818 IPR021190 IPR021158 IPR006026 IPR002477
Prosite:	PS00546 PS00142
Pfam:	PF00413 PF01471
CDD:	cd04278
PDB:	1MMP 1MMQ 1MMR 2DDY 2MZE 2MZH 2MZI 2Y6C 2Y6D
PDBsum:	1MMP 1MMQ 1MMR 2DDY 2MZE 2MZH 2MZI 2Y6C 2Y6D
MINT:	7709639
STRING:	ENSP00000260227;

Other Databases

GeneCards: MMP7; Malacards: MMP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0044849	estrous cycle	IEA	biological_process
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0044849	estrous cycle	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006508	proteolysis	TAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04310  Wnt signaling pathway
PTHR10201:SF143  CCKR signaling map
PTHR10201:SF143  CCKR signaling map
PTHR10201:SF143  CCKR signaling map
PTHR10201:SF143  CCKR signaling map

Diseases

Associated diseases	References
Abnormal sperm	PMID: 15979995
cancer	PMID: 15930031
Endometriosis	PMID: 16455621
Genital endometriosis	PMID: 25711032
Glomerulonephritis	PMID: 19420105
Implantation failure	PMID: 18077318
Multiple sclerosis	PMID: 18563468
Endometriosis	INFBASE27620811
Genital endometriosis	INFBASE25711032
Adenomyosis	INFBASE16455621
Rheumatoid arthritis	PMID: 16356191
Adenomyosis	PMID: 16455621

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21111772	Endometrio sis				Female infertility	PGE2 COX-2 MMP1 MMP2 MMP3 MMP7 MMP9 TIMP1 TIMP2 TIMP3 TIMP4	Show abstract
25711032	Endometrio sis (Genit al)	MMP3 (rs3025058), MMP7 (rs11568818), MMP9 (rs17576, rs2250889), MMP12 (rs2276109), and MMP13 (rs2252070)				MMP3 MMP7 MMP9 MMP12 MMP13	Show abstract
20007614	Endometrio sis			71 (13 samples of deep infiltr ating endometri osis, 11 sample s of ovarian en dometriosis, 23 samples of bla ck peritoneal l esions, 24 samp les of red peri toneal lesions)		MMP-7	Show abstract
16455621	Endometrio sis	MMP-7 (181A/G), MMP-9 (1562C/T)	Chinese	379 (219 patien ts (143 women w ith endometrios is, 76 women wi th adenomyosis) , 160 control w omen)	Female infertility	MMP-7 MMP-9	Show abstract
27620811	Endometrio sis	MMP1 (-1607 1G>2G polymorphism), MMP-2 (15918 T>C, -753 C>T), MMP7 (-181 A>G), MMP9 (-1562 C>T, R279Q)	English , Chine se	4023 (1833 pati ents, 2190 cont rols)		MMP9 MMP7 MMP2 MMP1	Show abstract