Endometriosis Knowledgebase

Search Result

Gene id

4318

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP9 Gene UCSC Ensembl

Aliases

CLG4B, GELB, MANDP2, MMP-9

Gene name

matrix metallopeptidase 9

Alternate names

matrix metalloproteinase-9, macrophage gelatinase, matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), type V collagenase,

Gene location

20q13.12 (46008907: 46016560) Exons: 13 NC_000020.11

Gene summary(Entrez)

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. [provided by RefSeq, Jul 2008]

OMIM

120361

SNPs

rs17576

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000682.2   g.46011586A>G
NC_000020.10   g.44640225A>G
NC_000020.11   g.46011586A>G
NG_011468.1   g.7679A>G
NM_004994.2   c.836A>G
NP_004985.2   p.Gln279Arg
Clinical Significance: Benign

rs3918242

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000682.2   g.46007337C>T
NC_000020.10   g.44635976C>T
NC_000020.11   g.46007337C>T
NG_011468.1   g.3430C>T
NM_004994.2   c.-1590C>T

Protein Summary

Protein general information

P14780

Name: Matrix metalloproteinase 9 (MMP 9) (EC 3.4.24.35) (92 kDa gelatinase) (92 kDa type IV collagenase) (Gelatinase B) (GELB) [Cleaved into: 67 kDa matrix metalloproteinase 9; 82 kDa matrix metalloproteinase 9]

Length: 707 Mass: 78,458

Tissue specificity: Produced by normal alveolar macrophages and granulocytes.

Sequence

MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQ
KQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSA
VTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNA
DGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCAT
TSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPE
PRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIA
EIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQ
DRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Structural information

Protein Domains	Fibronectin (225-273) Fibronectin (283-331) Fibronectin (342-390)
Motifs	Cysteine switch.(97-104)
Interpro:	IPR000562 IPR000585 IPR018487 IPR018486 IPR013806 IPR033739 IPR024079 IPR028688 IPR001818 IPR021190 IPR021158 IPR006026 IPR002477
Prosite:	PS00546 PS00023 PS51092 PS00024 PS51642 PS00142
Pfam:	PF00040 PF00045 PF00413 PF01471
CDD:	cd00062 cd00094 cd04278
PDB:	1GKC 1GKD 1ITV 1L6J 1LKG 2OVX 2OVZ 2OW0 2OW1 2OW2 4H1Q 4H2E 4H3X 4H82 4HMA 4JIJ 4JQG 4WZV 4XCT 5CUH 5I12 5TH6 5TH9
PDBsum:	1GKC 1GKD 1ITV 1L6J 1LKG 2OVX 2OVZ 2OW0 2OW1 2OW2 4H1Q 4H2E 4H3X 4H82 4HMA 4JIJ 4JQG 4WZV 4XCT 5CUH 5I12 5TH6 5TH9
DIP:	29518
MINT:	7709677
STRING:	ENSP00000361405;

Other Databases

GeneCards: MMP9; Malacards: MMP9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0004175	endopeptidase activity	EXP	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	EXP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030225	macrophage differentiatio n	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IMP	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0050900	leukocyte migration	IEA	biological_process
GO:0051549	positive regulation of ke ratinocyte migration	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:1900122	positive regulation of re ceptor binding	IDA	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001258	negative regulation of ca tion channel activity	IDA	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0004175	endopeptidase activity	EXP	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	EXP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	TAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0030225	macrophage differentiatio n	TAS	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0050900	leukocyte migration	IEA	biological_process
GO:0051549	positive regulation of ke ratinocyte migration	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:1900122	positive regulation of re ceptor binding	IDA	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001258	negative regulation of ca tion channel activity	IDA	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0004175	endopeptidase activity	EXP	molecular_function
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004175	endopeptidase activity	EXP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030225	macrophage differentiatio n	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IMP	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0051549	positive regulation of ke ratinocyte migration	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	IMP	biological_process
GO:1900122	positive regulation of re ceptor binding	IDA	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001258	negative regulation of ca tion channel activity	IDA	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa05202  Transcriptional misregulation in cancer
hsa04668  TNF signaling pathway
hsa01522  Endocrine resistance
hsa04657  IL-17 signaling pathway
hsa04915  Estrogen signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa05219  Bladder cancer
PTHR10201:SF30  CCKR signaling map
PTHR10201:SF30  CCKR signaling map

Diseases

Associated diseases	References
Adenomyosis	PMID: 16837781
Alzheimer's disease	PMID: 15748780
Amyotrophic lateral sclerosis (ALS)	PMID: 19484688
Aortic aneurysm	PMID: 15944607
Asthenozoospermia	PMID: 25562173
Asthma	PMID: 16061701
Bipolar disorder	PMID: 19536654
Bronchiectasis	PMID: 19188843
Chronic endometritis	PMID: 16984109
Chronic kidney failure	PMID: 12830465
Chronic obstructive pulmonary disease (COPD)	PMID: 15085249
Crohn's disease	PMID: 17589947
Dementia	PMID: 14550924
Diabetes	PMID: 19933990
Diabetic retinopathy	PMID: 18552985
Ectopic endometriosis	PMID: 15733405
Endometriosis	PMID: 22056701
Female infertility	PMID: 23054355
Genital endometriosis	PMID: 25711032
Gingivitis	PMID: 18930181
Glaucoma	PMID: 17110919
Glomerulonephritis	PMID: 19420105
Impaired reproduction	PMID: 18292822
Implantation failure	PMID: 12615834
Leiomyoma	PMID: 14597251
Macular degeneration	PMID: 15834245
Metaphyseal dysplasias	KEGG: H00479
Multiple sclerosis	PMID: 12127674
Myelopathy	PMID: 15465610
Nephropathy	PMID: 11576356
Osteoarthritis	PMID: 18802702
Ovarian endometriosis	PMID: 16815388
Penile cancer	KEGG: H00025
Periodontitis	PMID: 15691353
Genital endometriosis	INFBASE25711032
Implantation defects	INFBASE23979130
Endometrial carcinoma	INFBASE18295959
Endometriosis associated infertility	INFBASE23979130
Ectopic endometriosis	INFBASE15733405
Female infertility	INFBASE11821264
Endometriosis	INFBASE11821264
Polycystic ovary syndrome (PCOS)	PMID: 18569034
Preeclampsia	PMID: 18651887
Preterm delivery	PMID: 11994547
Recurrent implantation failure (RIF)	PMID: 12615834
Recurrent miscarriage	PMID: 17156190
Rheumatoid arthritis	PMID: 16356191
Schizophrenia	PMID: 19264454
Sjogren's syndrome	PMID: 15316122
Spinal diseases	PMID: 19444758
Systemic lupus erythematosus	PMID: 18571010
Unexplained infertility	PMID: 12895377
Adenomyosis	PMID: 16837781

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21111772	Endometrio sis					PGE2 COX-2 MMP1 MMP2 MMP3 MMP7 MMP9 TIMP1 TIMP2 TIMP3 TIMP4	Show abstract
19661147	Endometrio sis					ICAM1 MMP9 TNF MMP1	Show abstract
25711032	Endometrio sis (Genit al)	MMP3 (rs3025058), MMP7 (rs11568818), MMP9 (rs17576, rs2250889), MMP12 (rs2276109), and MMP13 (rs2252070)				MMP3 MMP7 MMP9 MMP12 MMP13	Show abstract
15733405	Endometrio sis (ectop ic)			77 (45 patients with endometri osis (study gro up), in 32 pati ents with uteri ne fibroid (con trol group))		MMP-9 TIMP-1	Show abstract
22056701	Endometrio sis			97		MMP2 MMP9 PCNA	Show abstract
11821264	Endometrio sis			43 (22 infertil e women with mi ld or moderate endometriosis, 21 control grou p of infertile patients)	Female infertility	MMP-9 TIMP-1	Show abstract
18584412	Endometrio sis			37 (15 mild end ometriosis, 22 severe endometr iosis)		MMP-2 MMP-9 TIMP-1 and TIMP-2	Show abstract
16635325	Endometrio sis			109 (38 specime ns of ovarian e ndometrioma (ov arian chocolate cysts, OCC), 1 6 red peritonea l endometriotic lesions (RPL), and 35 matched eutopic endome trium (Eu), 20 specimens of en dometrium from reproductive wo men undergoing laparoscopic su rgery without e		MMP-9 TIMP-1	Show abstract
18295959	Endometrio sis			40 (15 endometr iotic tissue, 1 5 low-grade end ometrial endome trioid carcinom as, 10 unremark able proliferat ive endometrium from women wit hout endometrio sis or carcinom a)		MMP-2 MMP-9 E-cadherin and beta-catenin	Show abstract
12587534	Endometrio sis			47 (35 women wi th endometriosi s, 12 women wit hout endometrio sis)		MMP-2 MMP-9 MT1-MMP	Show abstract
20100617	Endometrio sis	MMP-2 (-735 C/T), MMP-9 (-1562 C/T)	Caucasi an			MMP-2 MMP-9	Show abstract
18644593	Endometrio sis			60 (30 women wi th endometriosi s, 30 endometri um biopsy sampl es from 30 heal thy women)		ANGPT1 ANGPT2 MMP-1 MMP-2 MMP-9 VEGF	Show abstract
18554596	Endometrio sis	MMP-9 (-1562C>T, R279Q, P574R, and R668Q)	Korean	423 (225 patien ts with endomet riosis stage II I/IV, 198 contr ols)		MMP-9	Show abstract
16192641	Endometrio sis					MMP-9 PGE(2)	Show abstract
12107265	Endometrio sis			47 (35 women wi th endometriosi s, 12 women wit hout endometrio sis)		MMP-2 MMP-9 MT1-MMP survivin	Show abstract
26722547	Endometrio sis			100 EMS patient s, including eu topic endometri um and ectopic endometrium, we re recruited in this study alo ng with hystero myoma patients as the control group	Female infertility		Show abstract
26656198	Endometrio sis			6 endometriosis patients		MMP9 TIMP1 VEGFA	Show abstract
20378112	Endometrio sis					MMP-9 MMP-2 MMP-9/neutrophil gelatinase-associated lipocalin	Show abstract
16880228	Endometrio sis					MMP-9 TIMP-1	Show abstract
17888430	Endometrio sis			55 (25 with end ometriosis, 30 without endomet riosis)		c-fos MMP-9	Show abstract
12390721	Endometrio sis			30 women with e ndometriosis		MMP-9	Show abstract
23979130	Endometrio sis associ ated infer tility			57 (31 infertil e women with en dometriosis, 26 infertile wome n without endom etriosis)	Female infertility	HOXA-10 HOXA-11 MMP-2 MMP-9 integrin LIF	Show abstract
20378112	Endometrio sis					MMP-9 MMP-2 MMP-9/neutrophil gelatinase-associated lipocalin	Show abstract
29304094	Endometrio sis		Taiwane se			STIP1 MMP9	Show abstract
26965430	Endometrio sis					MMP-9 CLCN3	Show abstract
27620811	Endometrio sis	MMP1 (-1607 1G>2G polymorphism), MMP-2 (15918 T>C, -753 C>T), MMP7 (-181 A>G), MMP9 (-1562 C>T, R279Q)	English , Chine se	4023 (1833 pati ents, 2190 cont rols)		MMP9 MMP7 MMP2 MMP1	Show abstract