Endometriosis Knowledgebase

Search Result

Gene id

4320

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP11 Gene UCSC Ensembl

Aliases

SL-3, ST3, STMY3

Gene name

matrix metallopeptidase 11

Alternate names

stromelysin-3, matrix metallopeptidase 11 (stromelysin 3), stromelysin III,

Gene location

22q11.23 (23772818: 23784315) Exons: 8 NC_000022.11

Gene summary(Entrez)

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix. [provided by RefSeq, Jul 2008]

OMIM

185261

Protein Summary

Protein general information

P24347

Name: Stromelysin 3 (SL 3) (ST3) (EC 3.4.24. ) (Matrix metalloproteinase 11) (MMP 11)

Length: 488 Mass: 54,590

Tissue specificity: Specifically expressed in stromal cells of breast carcinomas.

Sequence

MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPAPAPATQEAPRPASSL
RPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHE
GRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQH
TTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGAQYWVYDGEKPVLGPA
PLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAFQDADGYAYFL
RGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL

Structural information

Motifs	Cysteine switch.(78-85)
Interpro:	IPR000585 IPR018487 IPR018486 IPR033739 IPR024079 IPR001818 IPR021190 IPR016293 IPR021158 IPR006026 IPR028705
Prosite:	PS00546 PS00024 PS51642 PS00142
Pfam:	PF00045 PF00413
CDD:	cd00094 cd04278
STRING:	ENSP00000215743;

Other Databases

GeneCards: MMP11; Malacards: MMP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IDA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030199	collagen fibril organizat ion	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0071711	basement membrane organiz ation	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IDA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0030199	collagen fibril organizat ion	IEA	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0071711	basement membrane organiz ation	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IDA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006508	proteolysis	TAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 19055724
Endometriosis	INFBASE19055724

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19055724	Endometrio sis			4 (3 endometrio tic tissues, 1 normal tissue)		MMP1 MMP2 MMP3 MMP10 MMP11 MMP14 IGF2 ACTN4 AXL and SHC1	Show abstract