Endometriosis Knowledgebase

Search Result

Gene id

4323

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP14 Gene UCSC Ensembl

Aliases

MMP-14, MMP-X1, MT-MMP, MT-MMP 1, MT1-MMP, MT1MMP, MTMMP1, WNCHRS

Gene name

matrix metallopeptidase 14

Alternate names

matrix metalloproteinase-14, matrix metallopeptidase 14 (membrane-inserted), membrane type 1 metalloprotease, membrane-type-1 matrix metalloproteinase,

Gene location

14q11.2 (22836532: 22847599) Exons: 10 NC_000014.9

Gene summary(Entrez)

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. [provided by RefSeq, Jul 2008]

OMIM

600754

Protein Summary

Protein general information

P50281

Name: Matrix metalloproteinase 14 (MMP 14) (EC 3.4.24.80) (MMP X1) (Membrane type matrix metalloproteinase 1) (MT MMP 1) (MTMMP1) (Membrane type 1 matrix metalloproteinase) (MT1 MMP) (MT1MMP)

Length: 582 Mass: 65,894

Tissue specificity: Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors. {ECO

Sequence

MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQ
VTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRV
WESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRN
EDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERK
DGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYP
KNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVI
IIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Structural information

Motifs	Cysteine switch.(91-98)
Interpro:	IPR000585 IPR018487 IPR018486 IPR033739 IPR024079 IPR028693 IPR001818 IPR021190 IPR021805 IPR016293 IPR021158 IPR006026 IPR002477
Prosite:	PS00546 PS00024 PS51642 PS00142
Pfam:	PF11857 PF00045 PF00413 PF01471
CDD:	cd00094 cd04278
PDB:	1BQQ 1BUV 2MQS 3C7X 3MA2 3X23 4P3C 4P3D 4QXU
PDBsum:	1BQQ 1BUV 2MQS 3C7X 3MA2 3X23 4P3C 4P3D 4QXU
DIP:	35111
MINT:	246780
STRING:	ENSP00000308208;

Other Databases

GeneCards: MMP14; Malacards: MMP14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0001958	endochondral ossification	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	ISS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008584	male gonad development	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010831	positive regulation of my otube differentiation	ISS	biological_process
GO:0010952	positive regulation of pe ptidase activity	IEA	biological_process
GO:0016504	peptidase activator activ ity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0031638	zymogen activation	IEA	biological_process
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0035988	chondrocyte proliferation	IEA	biological_process
GO:0042470	melanosome	IEA	cellular_component
GO:0043615	astrocyte cell migration	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0044354	macropinosome	IDA	cellular_component
GO:0045579	positive regulation of B cell differentiation	ISS	biological_process
GO:0045746	negative regulation of No tch signaling pathway	ISS	biological_process
GO:0048701	embryonic cranial skeleto n morphogenesis	IEA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0048771	tissue remodeling	IEA	biological_process
GO:0051895	negative regulation of fo cal adhesion assembly	IEA	biological_process
GO:0097094	craniofacial suture morph ogenesis	IEA	biological_process
GO:0005737	cytoplasm	IDA	cellular_component
GO:0001503	ossification	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0001958	endochondral ossification	IEA	biological_process
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	ISS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0008584	male gonad development	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009725	response to hormone	IEA	biological_process
GO:0010831	positive regulation of my otube differentiation	IEA	biological_process
GO:0010831	positive regulation of my otube differentiation	ISS	biological_process
GO:0010952	positive regulation of pe ptidase activity	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016477	cell migration	IEA	biological_process
GO:0016504	peptidase activator activ ity	IEA	molecular_function
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030574	collagen catabolic proces s	IEA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0031638	zymogen activation	IEA	biological_process
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0035988	chondrocyte proliferation	IEA	biological_process
GO:0042470	melanosome	IEA	cellular_component
GO:0043615	astrocyte cell migration	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0044354	macropinosome	IDA	cellular_component
GO:0045579	positive regulation of B cell differentiation	IEA	biological_process
GO:0045579	positive regulation of B cell differentiation	ISS	biological_process
GO:0045746	negative regulation of No tch signaling pathway	IEA	biological_process
GO:0045746	negative regulation of No tch signaling pathway	ISS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048701	embryonic cranial skeleto n morphogenesis	IEA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0048771	tissue remodeling	IEA	biological_process
GO:0051895	negative regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060348	bone development	IEA	biological_process
GO:0097094	craniofacial suture morph ogenesis	IEA	biological_process
GO:0005737	cytoplasm	IDA	cellular_component
GO:0004222	metalloendopeptidase acti vity	ISS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0010831	positive regulation of my otube differentiation	ISS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030574	collagen catabolic proces s	TAS	biological_process
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0044354	macropinosome	IDA	cellular_component
GO:0045579	positive regulation of B cell differentiation	ISS	biological_process
GO:0045746	negative regulation of No tch signaling pathway	ISS	biological_process
GO:0005737	cytoplasm	IDA	cellular_component

KEGG pathways

hsa04668 TNF signaling pathway
hsa04912 GnRH signaling pathway

Diseases

Associated diseases	References
Bronchopulmonary dysplasia	PMID: 18784838
Cancer	PMID: 19074885
Chronic obstructive pulmonary disease (COPD)	PMID: 16525718
Endometrial cancer	PMID: 26842619
Endometriosis	PMID: 16109597
Endometriosis	PMID: 23011643
Glomerulosclerosis	PMID: 18927121
Implantation defects	INFBASE23011643
Endometriosis	INFBASE12107265

PubMed references

PMID	Condition	Mutation	Population details	Associated_genes	Abstract
19055724	Endometrio sis		4 (3 endometrio tic tissues, 1 normal tissue)	MMP1 MMP2 MMP3 MMP10 MMP11 MMP14 IGF2 ACTN4 AXL and SHC1	Show abstract
16109597	Endometrio sis		38 (20 women wi th endometriosi s, 18 controls)	MMP-13 MT1-MMP/MMP-14 TIMP-2	Show abstract
12372458	Endometrio sis	MMP-2, MT1-MMP, TIMP-2	53 (23 with end ometriosis and 30 without endo metriosis)	MMP-2 MT1-MMP TIMP-2	Show abstract
12107265	Endometrio sis		47 (35 women wi th endometriosi s, 12 women wit hout endometrio sis)	MMP-2 MMP-9 MT1-MMP survivin	Show abstract
23011643	Endometrio sis		265 (194 patien ts affected by endometriosis, 71 patients wit h normal endome trium)	MMP-2 MT1-MMP TIMP-2	Show abstract
12587534	Endometrio sis		47 (35 women wi th endometriosi s, 12 women wit hout endometrio sis)	MMP-2 MMP-9 MT1-MMP	Show abstract