Endometriosis Knowledgebase

Search Result

Gene id

4353

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MPO Gene UCSC Ensembl

Gene name

myeloperoxidase

Alternate names

myeloperoxidase,

Gene location

17q22 (58280934: 58269855) Exons: 12 NC_000017.11

Gene summary(Entrez)

Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils. [provided by RefSeq, Nov 2014]

OMIM

606989

SNPs

rs2333227

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000679.2   g.58281401C>T
NC_000017.10   g.56358762C>T
NC_000017.11   g.58281401C>T
NG_009629.1   g.4535G>A
NG_044959.1   g.1914C>T
NM_000250.1   c.-643G>A

Protein Summary

Protein general information

P05164

Name: Myeloperoxidase (MPO) (EC 1.11.2.2) [Cleaved into: Myeloperoxidase; 89 kDa myeloperoxidase; 84 kDa myeloperoxidase; Myeloperoxidase light chain; Myeloperoxidase heavy chain]

Length: 745 Mass: 83,869

Sequence

MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAKQLVDK
AYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNVTDVLTPAQLN
VLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVA
LARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRA
LLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIV
GAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRV
PLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDG
DRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS

Structural information

Interpro:	IPR010255 IPR019791 IPR029609
Prosite:	PS00435 PS50292
Pfam:	PF03098
PDB:	1CXP 1D2V 1D5L 1D7W 1DNU 1DNW 1MHL 1MYP 3F9P 3ZS0 3ZS1 4C1M 4DL1 4EJX 5FIW
PDBsum:	1CXP 1D2V 1D5L 1D7W 1DNU 1DNW 1MHL 1MYP 3F9P 3ZS0 3ZS1 4C1M 4DL1 4EJX 5FIW
MINT:	1522833
STRING:	ENSP00000225275;

Other Databases

GeneCards: MPO; Malacards: MPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001878	response to yeast	IEA	biological_process
GO:0002149	hypochlorous acid biosynt hetic process	IEA	biological_process
GO:0002679	respiratory burst involve d in defense response	IEA	biological_process
GO:0003682	chromatin binding	TAS	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005764	lysosome	TAS	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0006979	response to oxidative str ess	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0019430	removal of superoxide rad icals	IEA	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0030141	secretory granule	IDA	cellular_component
GO:0032094	response to food	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0034374	low-density lipoprotein p article remodeling	IDA	biological_process
GO:0042582	azurophil granule	IDA	cellular_component
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050832	defense response to fungu s	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1990268	response to gold nanopart icle	IEA	biological_process
GO:0001878	response to yeast	IEA	biological_process
GO:0002149	hypochlorous acid biosynt hetic process	IEA	biological_process
GO:0002149	hypochlorous acid biosynt hetic process	IEA	biological_process
GO:0002679	respiratory burst involve d in defense response	IEA	biological_process
GO:0003682	chromatin binding	TAS	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	TAS	cellular_component
GO:0006952	defense response	IEA	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0006979	response to oxidative str ess	TAS	biological_process
GO:0006979	response to oxidative str ess	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0019430	removal of superoxide rad icals	IEA	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0030141	secretory granule	IDA	cellular_component
GO:0032094	response to food	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0034374	low-density lipoprotein p article remodeling	IDA	biological_process
GO:0042582	azurophil granule	IDA	cellular_component
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050832	defense response to fungu s	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1990268	response to gold nanopart icle	IEA	biological_process
GO:0003682	chromatin binding	TAS	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0004601	peroxidase activity	TAS	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0004601	peroxidase activity	IDA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005764	lysosome	TAS	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0006979	response to oxidative str ess	TAS	biological_process
GO:0006979	response to oxidative str ess	TAS	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0030141	secretory granule	IDA	cellular_component
GO:0034374	low-density lipoprotein p article remodeling	IDA	biological_process
GO:0042582	azurophil granule	IDA	cellular_component
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa05202 Transcriptional misregulation in cancer
hsa04145 Phagosome

Diseases

Associated diseases	References
Agranulocytosis	PMID: 11147929
Alzheimer's disease	PMID: 15023809
Asthma	PMID: 16385446
Atherosclerosis	PMID: 12355548
Cancer	PMID: 19963114
Chronic kidney failure	PMID: 15068388
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Defective endometrial receptivity	PMID: 25935494
Diabetes	PMID: 12355548
Endometriosis	PMID: 17611835
Eye diseases	PMID: 18447907
Gastric disease	PMID: 17451207
Glomerulonephritis	PMID: 19420105
Multiple sclerosis	PMID: 15222689
Ovarian hyperstimulation syndrome(OHSS)	PMID: 22344731
Periodontal disease	PMID: 11960308
Endometriosis associated infertility	INFBASE22435532
Endometriosis	INFBASE22435532
Polycystic ovary syndrome (PCOS)	PMID: 21756068
Preeclampsia	PMID: 23905607

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22435532	Endometrio sis			38 (18 endometr iosis anovulati on, 20 normally ovulating)	Female infertility		Show abstract
17611835	Endometrio sis			32 (18 patients with endometri osis, 14 contro ls without endo metriosis)		Lactoferrin myeloperoxidase cancer antigen 125	Show abstract