Endometriosis Knowledgebase

Search Result

Gene id

4485

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MST1 Gene UCSC Ensembl

Aliases

D3F15S2, DNF15S2, HGFL, MSP, NF15S2

Gene name

macrophage stimulating 1

Alternate names

hepatocyte growth factor-like protein, hepatocyte growth factor-like protein homolog, macrophage stimulating 1 (hepatocyte growth factor-like), macrophage-stimulating protein,

Gene location

3p21.31 (79601951: 79202623) Exons: 7 NC_000016.10

Gene summary(Entrez)

The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds. [provided by RefSeq, Jan 2010]

OMIM

142408

Protein Summary

Protein general information

P26927

Name: Hepatocyte growth factor-like protein (Macrophage stimulatory protein) (Macrophage-stimulating protein) (MSP) [Cleaved into: Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain]

Length: 711 Mass: 80,320

Sequence

MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSS
HGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRN
GLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPF
EPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA
GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRRCTDDVRPQDCYHGAG
EQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCAD
DQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFS
SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT
KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVL
EGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG

Structural information

Protein Domains	PAN. (21-105) Kringle (110-186) Kringle (191-268) Kringle (283-361)
Interpro:	IPR024174 IPR000001 IPR013806 IPR018056 IPR038178 IPR003609 IPR009003 IPR001314 IPR001254
Prosite:	PS00021 PS50070 PS50948 PS50240
Pfam:	PF00051 PF00024 PF00089
CDD:	cd00190
PDB:	2ASU 4QT8
PDBsum:	2ASU 4QT8
DIP:	6028
MINT:
STRING:	ENSP00000414287;

Other Databases

GeneCards: MST1; Malacards: MST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular_function
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular_function
GO:0045721	negative regulation of gl uconeogenesis	IDA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000479	regulation of cAMP-depend ent protein kinase activi ty	IDA	biological_process
GO:0003674	molecular_function	ND	molecular_function
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular_function
GO:0045721	negative regulation of gl uconeogenesis	IDA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000479	regulation of cAMP-depend ent protein kinase activi ty	IDA	biological_process
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular_function
GO:0045721	negative regulation of gl uconeogenesis	IDA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000479	regulation of cAMP-depend ent protein kinase activi ty	IDA	biological_process

Diseases

Associated diseases	References
Ulcerative colitis	GAD18438406
Inflammatory bowel disease	GAD20024904
Crohn's disease	GAD18587394
Cholangitis	GAD21151127
Endometriosis	PubMed29448246
Inflammatory bowel disease	KEGGH01227
Ulcerative colitis	KEGGH01466

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
29448246	Endometrio sis						Show abstract