Endometriosis Knowledgebase

Search Result

Gene id

4513

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

COX2 Gene UCSC Ensembl

Aliases

COII, MTCO2

Gene name

mitochondrially encoded cytochrome c oxidase II

Protein Summary

Protein general information

P00403

Name: Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II)

Length: 227 Mass: 25,565

Sequence

MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVL
IALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPI
RMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVF
TL

Structural information

Interpro:	IPR002429 IPR034210 IPR001505 IPR008972 IPR014222 IPR011759
Prosite:	PS00078 PS50857 PS50999
Pfam:	PF00116 PF02790
CDD:	cd13912
PDB:	3VRJ
PDBsum:	3VRJ
MINT:	2799304
STRING:	ENSP00000354876;

Other Databases

GeneCards: MT-CO2; Malacards: MT-CO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004129	cytochrome-c oxidase acti vity	NAS	molecular_function
GO:0005507	copper ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	TAS	cellular_component
GO:0006123	mitochondrial electron tr ansport, cytochrome c to oxygen	NAS	biological_process
GO:0006123	mitochondrial electron tr ansport, cytochrome c to oxygen	TAS	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0045277	respiratory chain complex IV	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902600	hydrogen ion transmembran e transport	IEA	biological_process
GO:0004129	cytochrome-c oxidase acti vity	IMP	molecular_function
GO:0004129	cytochrome-c oxidase acti vity	IEA	molecular_function
GO:0004129	cytochrome-c oxidase acti vity	NAS	molecular_function
GO:0005507	copper ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	TAS	cellular_component
GO:0006123	mitochondrial electron tr ansport, cytochrome c to oxygen	NAS	biological_process
GO:0006123	mitochondrial electron tr ansport, cytochrome c to oxygen	TAS	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0022900	electron transport chain	IEA	biological_process
GO:0045277	respiratory chain complex IV	IDA	cellular_component
GO:0046872	metal ion binding	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070469	respiratory chain	IEA	cellular_component
GO:1902600	hydrogen ion transmembran e transport	IEA	biological_process
GO:0004129	cytochrome-c oxidase acti vity	IMP	molecular_function
GO:0004129	cytochrome-c oxidase acti vity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	TAS	cellular_component
GO:0006123	mitochondrial electron tr ansport, cytochrome c to oxygen	NAS	biological_process
GO:0006123	mitochondrial electron tr ansport, cytochrome c to oxygen	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0045277	respiratory chain complex IV	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0004129	cytochrome-c oxidase acti vity	IMP	molecular_function

KEGG pathways

hsa01100  Metabolic pathways
hsa04932  Non-alcoholic fatty liver disease
hsa05016  Huntington's disease
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa00190  Oxidative phosphorylation
hsa04260  Cardiac muscle contraction
PTHR11903:SF8  CCKR signaling map
PTHR11903:SF8  CCKR signaling map
PTHR11903:SF8  CCKR signaling map

Diseases

Associated diseases	References
Cancer	PMID: 18509181
Diabetes	PMID: 19758471
Endometriosis	PMID: 22587873
Endometriosis	INFBASE22587873
Pregnancy loss	PMID: 19297417
Spinocerebellar ataxia	PMID: 19066432

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22587873	Endometrio sis	(-765G/C polymorphism )	Korean	510 (268 women with advanced-s tage endometrio sis, 242 contro l women without endometriosis)			Show abstract