Endometriosis Knowledgebase

Search Result

Gene id

4609

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MYC Gene UCSC Ensembl

Aliases

MRTL, MYCC, bHLHe39, c-Myc

Gene name

MYC proto-oncogene, bHLH transcription factor

Alternate names

myc proto-oncogene protein, avian myelocytomatosis viral oncogene homolog, class E basic helix-loop-helix protein 39, myc-related translation/localization regulatory factor, proto-oncogene c-Myc, transcription factor p64, v-myc avian myelocytomatosis viral onco,

Gene location

8q24.21 (127736068: 127741433) Exons: 3 NC_000008.11

Gene summary(Entrez)

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. [provided by RefSeq, Jul 2008]

OMIM

190080

Protein Summary

Protein general information

P01106

Name: Myc proto oncogene protein (Class E basic helix loop helix protein 39) (bHLHe39) (Proto oncogene c Myc) (Transcription factor p64)

Length: 439 Mass: 48,804

Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYV
AVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLA
SYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFF
ALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Structural information

Protein Domains	bHLH. (354-406)
Interpro:	IPR011598 IPR003327 IPR002418 IPR012682
Prosite:	PS50888
Pfam:	PF00010 PF02344 PF01056
CDD:	cd00083
PDB:	1A93 1EE4 1MV0 1NKP 2A93 2OR9 4Y7R 5I4Z 5I50
PDBsum:	1A93 1EE4 1MV0 1NKP 2A93 2OR9 4Y7R 5I4Z 5I50
DIP:	28143
MINT:	257327
STRING:	ENSP00000367207;

Other Databases

GeneCards: MYC; Malacards: MYC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001658	branching involved in ure teric bud morphogenesis	ISS	biological_process
GO:0002053	positive regulation of me senchymal cell proliferat ion	ISS	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006112	energy reserve metabolic process	NAS	biological_process
GO:0006338	chromatin remodeling	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006879	cellular iron ion homeost asis	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010332	response to gamma radiati on	IDA	biological_process
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0015671	oxygen transport	NAS	biological_process
GO:0032204	regulation of telomere ma intenance	IMP	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0032873	negative regulation of st ress-activated MAPK casca de	ISS	biological_process
GO:0034644	cellular response to UV	IEP	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0042493	response to drug	IEP	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0044346	fibroblast apoptotic proc ess	TAS	biological_process
GO:0045656	negative regulation of mo nocyte differentiation	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048147	negative regulation of fi broblast proliferation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0051276	chromosome organization	IDA	biological_process
GO:0051782	negative regulation of ce ll division	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070848	response to growth factor	TAS	biological_process
GO:0070888	E-box binding	IDA	molecular_function
GO:0090096	positive regulation of me tanephric cap mesenchymal cell proliferation	ISS	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IMP	biological_process
GO:2001022	positive regulation of re sponse to DNA damage stim ulus	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001658	branching involved in ure teric bud morphogenesis	ISS	biological_process
GO:0002053	positive regulation of me senchymal cell proliferat ion	ISS	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006112	energy reserve metabolic process	NAS	biological_process
GO:0006338	chromatin remodeling	IDA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006879	cellular iron ion homeost asis	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010332	response to gamma radiati on	IDA	biological_process
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0015671	oxygen transport	NAS	biological_process
GO:0032204	regulation of telomere ma intenance	IMP	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0032873	negative regulation of st ress-activated MAPK casca de	ISS	biological_process
GO:0034644	cellular response to UV	IEP	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0042493	response to drug	IEP	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0044346	fibroblast apoptotic proc ess	TAS	biological_process
GO:0045656	negative regulation of mo nocyte differentiation	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048147	negative regulation of fi broblast proliferation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0051276	chromosome organization	IDA	biological_process
GO:0051782	negative regulation of ce ll division	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070848	response to growth factor	TAS	biological_process
GO:0070888	E-box binding	IDA	molecular_function
GO:0090096	positive regulation of me tanephric cap mesenchymal cell proliferation	ISS	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IMP	biological_process
GO:2001022	positive regulation of re sponse to DNA damage stim ulus	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001658	branching involved in ure teric bud morphogenesis	ISS	biological_process
GO:0002053	positive regulation of me senchymal cell proliferat ion	ISS	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006112	energy reserve metabolic process	NAS	biological_process
GO:0006338	chromatin remodeling	IDA	biological_process
GO:0006879	cellular iron ion homeost asis	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010332	response to gamma radiati on	IDA	biological_process
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0015671	oxygen transport	NAS	biological_process
GO:0032204	regulation of telomere ma intenance	IMP	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0032873	negative regulation of st ress-activated MAPK casca de	ISS	biological_process
GO:0034644	cellular response to UV	IEP	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0042493	response to drug	IEP	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0044346	fibroblast apoptotic proc ess	TAS	biological_process
GO:0045656	negative regulation of mo nocyte differentiation	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048147	negative regulation of fi broblast proliferation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0051276	chromosome organization	IDA	biological_process
GO:0051782	negative regulation of ce ll division	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070848	response to growth factor	TAS	biological_process
GO:0070888	E-box binding	IDA	molecular_function
GO:0090096	positive regulation of me tanephric cap mesenchymal cell proliferation	ISS	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IMP	biological_process
GO:2001022	positive regulation of re sponse to DNA damage stim ulus	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05161  Hepatitis B
hsa05224  Breast cancer
hsa04630  Jak-STAT signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04110  Cell cycle
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05210  Colorectal cancer
hsa04012  ErbB signaling pathway
hsa04350  TGF-beta signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa05219  Bladder cancer
hsa05213  Endometrial cancer
hsa04310  Wnt signaling pathway
hsa05221  Acute myeloid leukemia
PTHR11514:SF2  CCKR signaling map
hsa05216  Thyroid cancer
PTHR11514:SF2  CCKR signaling map
PTHR11514:SF2  CCKR signaling map
PTHR11514:SF2  p53 pathway feedback loops 2
PTHR11514:SF2  CCKR signaling map
PTHR11514:SF2  Oxidative stress response
PTHR11514:SF2  p53 pathway feedback loops 2
PTHR11514:SF2  Oxidative stress response

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
B lymphoblastic leukemia	KEGG: H00001
Breast cancer	KEGG: H00031
Burkitt lymphoma	KEGG: H00008
Choriocarcinoma	KEGG: H00028
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometriosis	PMID: 22884659
Fallopian tube cancer	KEGG: H01554
Kaposi's sarcoma	KEGG: H00041
Laryngeal cancer	KEGG: H00055
Male infertility	PMID: 22771312
Medulloblastoma	KEGG: H01667
Multiple myeloma	KEGG: H00010
Mycosis fungoides	KEGG: H01463
Oral cancer	KEGG: H00016
Osteosarcoma	KEGG: H00036
Ovarian cancer	KEGG: H00027
Ovarian endometriosis	PMID: 23006437
Ovarian endometriosis	PMID: 23006437
Ovarian endometriosis	INFBASE23006437
Endometriosis	INFBASE1707594
Penile cancer	KEGG: H00025
Endometriosis	INFBASE25546156
Small cell lung cancer	KEGG: H00013
T lymphoblastic leukemia	KEGG: H00002
Tonsillar cancer	KEGG: H01509

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22884659	Endometrio sis	91 (59 patients with endometri osis, 32 contro ls)		c-myc cyclin D1 GREB1	Show abstract
16150151	Endometrio sis	64 (30 women wi th endometriosi s, 34 fertile e umenorrheic wom en )		C-myc TGF-beta1 Bax	Show abstract
9458291	Endometrio sis	16 patients wit h histologicall y verified pelv ic endometriosi s		c-myc c-erb-B2 nm23 and p53	Show abstract
1707594	Endometrio sis			c-myc	Show abstract
25546156	Endometrio sis		Female infertility	NOTCH1 NOTCH4 JAGGED2 DLL4 HES5 HEY1	Show abstract
19200988	Endometrio sis	28 (17 patients in whom endome triosis, 11 hea lthy fertile wo men)		MYC	Show abstract
23006437	Endometrio sis (ovari an)	18 (8 moderate endometriosis, 10 severe endom etriosis)		CLOCK ESR1 and MYC	Show abstract
26198055	Endometrio sis	121 (47 control s, 74 patients with endometrio sis)		CDH1 TWIST1 SNAIL SLUG MYC	Show abstract