Endometriosis Knowledgebase

Search Result

Gene id

472

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ATM Gene UCSC Ensembl

Aliases

AT1, ATA, ATC, ATD, ATDC, ATE, TEL1, TELO1

Gene name

ATM serine/threonine kinase

Alternate names

serine-protein kinase ATM, A-T mutated, AT mutated, TEL1, telomere maintenance 1, homolog, ataxia telangiectasia mutated,

Gene location

11q22.3 (108222483: 108369101) Exons: 69 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder. [provided by RefSeq, Aug 2010]

OMIM

607585

Protein Summary

Protein general information

Q13315

Name: Serine protein kinase ATM (EC 2.7.11.1) (Ataxia telangiectasia mutated) (A T mutated)

Length: 3056 Mass: 350,687

Tissue specificity: Found in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, spleen, thymus, testis, ovary, small intestine, colon and leukocytes.

Sequence

MSLVLNDLLICCRQLEHDRATERKKEVEKFKRLIRDPETIKHLDRHSDSKQGKYLNWDAVFRFLQKYIQKETECL
RIAKPNVSASTQASRQKKMQEISSLVKYFIKCANRRAPRLKCQELLNYIMDTVKDSSNGAIYGADCSNILLKDIL
SVRKYWCEISQQQWLELFSVYFRLYLKPSQDVHRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQCARQEKS
SSGLNHILAALTIFLKTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYESTKWRSILYNLYDLLVNEISHIGSRGKYSSGFRNIAVKENLIELMADICHQVFNEDTRSLEISQSYTTTQR
ESSDYSVPCKRKKIELGWEVIKDHLQKSQNDFDLVPWLQIATQLISKYPASLPNCELSPLLMILSQLLPQQRHGE
RTPYVLRCLTEVALCQDKRSNLESSQKSDLLKLWNKIWCITFRGISSEQIQAENFGLLGAIIQGSLVEVDREFWK
LFTGSACRPSCPAVCCLTLALTTSIVPGTVKMGIEQNMCEVNRSFSLKESIMKWLLFYQLEGDLENSTEVPPILH
SNFPHLVLEKILVSLTMKNCKAAMNFFQSVPECEHHQKDKEELSFSEVEELFLQTTFDKMDFLTIVRECGIEKHQ
SSIGFSVHQNLKESLDRCLLGLSEQLLNNYSSEITNSETLVRCSRLLVGVLGCYCYMGVIAEEEAYKSELFQKAK
SLMQCAGESITLFKNKTNEEFRIGSLRNMMQLCTRCLSNCTKKSPNKIASGFFLRLLTSKLMNDIADICKSLASF
IKKPFDRGEVESMEDDTNGNLMEVEDQSSMNLFNDYPDSSVSDANEPGESQSTIGAINPLAEEYLSKQDLLFLDM
LKFLCLCVTTAQTNTVSFRAADIRRKLLMLIDSSTLEPTKSLHLHMYLMLLKELPGEEYPLPMEDVLELLKPLSN
VCSLYRRDQDVCKTILNHVLHVVKNLGQSNMDSENTRDAQGQFLTVIGAFWHLTKERKYIFSVRMALVNCLKTLL
EADPYSKWAILNVMGKDFPVNEVFTQFLADNHHQVRMLAAESINRLFQDTKGDSSRLLKALPLKLQQTAFENAYL
KAQEGMREMSHSAENPETLDEIYNRKSVLLTLIAVVLSCSPICEKQALFALCKSVKENGLEPHLVKKVLEKVSET
FGYRRLEDFMASHLDYLVLEWLNLQDTEYNLSSFPFILLNYTNIEDFYRSCYKVLIPHLVIRSHFDEVKSIANQI
QEDWKSLLTDCFPKILVNILPYFAYEGTRDSGMAQQRETATKVYDMLKSENLLGKQIDHLFISNLPEIVVELLMT
LHEPANSSASQSTDLCDFSGDLDPAPNPPHFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQ
AAETNNVYKKHRILKIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQRPSCIMDVSLRSFSLCCDLLSQ
VCQTAVTYCKDALENHLHVIVGTLIPLVYEQVEVQKQVLDLLKYLVIDNKDNENLYITIKLLDPFPDHVVFKDLR
ITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRRQLELHKDQMVDIMRASQDNPQDGIMVKLVVN
LLQLSKMAINHTGEKEVLEAVGSCLGEVGPIDFSTIAIQHSKDASYTKALKLFEDKELQWTFIMLTYLNNTLVED
CVKVRSAAVTCLKNILATKTGHSFWEIYKMTTDPMLAYLQPFRTSRKKFLEVPRFDKENPFEGLDDINLWIPLSE
NHDIWIKTLTCAFLDSGGTKCEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWRNLLSTHVQGFFTSCLR
HFSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVDYMRRQKRPSSGTIFNDAFWLDLNYLEVAKVAQSCAA
HFTALLYAEIYADKKSMDDQEKRSLAFEEGSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGK
MLQPITRLRTYEHEAMWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILSVYLKGLDYENKDWCPELEELHY
QAAWRNMQWDHCTSVSKEVEGTSYHESLYNALQSLRDREFSTFYESLKYARVKEVEEMCKRSLESVYSLYPTLSR
LQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKDSDFSFQEPIMALRTVILEILMEKEMDNSQRECIKDI
LTKHLVELSILARTFKNTQLPERAIFQIKQYNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAA
NNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQR
IENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLL
SGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISM
DHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCD
AYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPK
IIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVPLSQRSGVLEWCTGTVP
IGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVFMDVCQNFQPVFRYFCMEKFLDPAIWFEKRL
AYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEG
VFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQ
SFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV

Structural information

Protein Domains	FAT. (1960-2566) PI3K/PI4K. (2712-2962) FATC. (3024-3056)
Interpro:	IPR011989 IPR016024 IPR003152 IPR011009 IPR000403 IPR018936 IPR003151 IPR014009 IPR021668
Prosite:	PS51189 PS51190 PS00915 PS00916 PS50290
Pfam:	PF02259 PF02260 PF00454 PF11640
DIP:	182
MINT:	194471
STRING:	ENSP00000278616;

Other Databases

GeneCards: ATM; Malacards: ATM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000724	double-strand break repai r via homologous recombin ation	IEA	biological_process
GO:0000729	DNA double-strand break p rocessing	TAS	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001756	somitogenesis	IEA	biological_process
GO:0002331	pre-B cell allelic exclus ion	ISS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004677	DNA-dependent protein kin ase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	IBA	biological_process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006975	DNA damage induced protei n phosphorylation	IDA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	IGI	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological_process
GO:0007131	reciprocal meiotic recomb ination	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008340	determination of adult li fespan	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0010212	response to ionizing radi ation	IDA	biological_process
GO:0010212	response to ionizing radi ation	IDA	biological_process
GO:0010506	regulation of autophagy	IMP	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	IMP	molecular_function
GO:0016572	histone phosphorylation	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0030889	negative regulation of B cell proliferation	IMP	biological_process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	ISS	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0033129	positive regulation of hi stone phosphorylation	IEA	biological_process
GO:0033151	V(D)J recombination	IEA	biological_process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0036289	peptidyl-serine autophosp horylation	IMP	biological_process
GO:0042159	lipoprotein catabolic pro cess	IEA	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043517	positive regulation of DN A damage response, signal transduction by p53 clas s mediator	IMP	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0045141	meiotic telomere clusteri ng	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046983	protein dimerization acti vity	IDA	molecular_function
GO:0047485	protein N-terminus bindin g	IDA	molecular_function
GO:0048599	oocyte development	IEA	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0071044	histone mRNA catabolic pr ocess	IDA	biological_process
GO:0071480	cellular response to gamm a radiation	IDA	biological_process
GO:0071500	cellular response to nitr osative stress	IDA	biological_process
GO:0072434	signal transduction invol ved in mitotic G2 DNA dam age checkpoint	IMP	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:0097694	establishment of RNA loca lization to telomere	IMP	biological_process
GO:0097695	establishment of macromol ecular complex localizati on to telomere	IC	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1904262	negative regulation of TO RC1 signaling	IMP	biological_process
GO:1904354	negative regulation of te lomere capping	IMP	biological_process
GO:1904358	positive regulation of te lomere maintenance via te lomere lengthening	IMP	biological_process
GO:1904358	positive regulation of te lomere maintenance via te lomere lengthening	IMP	biological_process
GO:1904884	positive regulation of te lomerase catalytic core c omplex assembly	IMP	biological_process
GO:1990391	DNA repair complex	IDA	cellular_component
GO:0051972	regulation of telomerase activity	IMP	biological_process
GO:0000781	chromosome, telomeric reg ion	IDA	cellular_component
GO:0000784	nuclear chromosome, telom eric region	IC	cellular_component
GO:0000077	DNA damage checkpoint	IEA	biological_process
GO:0000077	DNA damage checkpoint	IEA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000723	telomere maintenance	IEA	biological_process
GO:0000724	double-strand break repai r via homologous recombin ation	IEA	biological_process
GO:0000729	DNA double-strand break p rocessing	TAS	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001756	somitogenesis	IEA	biological_process
GO:0002331	pre-B cell allelic exclus ion	IEA	biological_process
GO:0002331	pre-B cell allelic exclus ion	ISS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004677	DNA-dependent protein kin ase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006281	DNA repair	IBA	biological_process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006975	DNA damage induced protei n phosphorylation	IDA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	IGI	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological_process
GO:0007131	reciprocal meiotic recomb ination	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007292	female gamete generation	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008340	determination of adult li fespan	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0010212	response to ionizing radi ation	IEA	biological_process
GO:0010212	response to ionizing radi ation	IEA	biological_process
GO:0010212	response to ionizing radi ation	IDA	biological_process
GO:0010212	response to ionizing radi ation	IDA	biological_process
GO:0010506	regulation of autophagy	IMP	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IEA	molecular_function
GO:0016303	1-phosphatidylinositol-3- kinase activity	IMP	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016572	histone phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0030889	negative regulation of B cell proliferation	IMP	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IEA	biological_process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	ISS	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0033129	positive regulation of hi stone phosphorylation	IEA	biological_process
GO:0033151	V(D)J recombination	IEA	biological_process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0036289	peptidyl-serine autophosp horylation	IMP	biological_process
GO:0042159	lipoprotein catabolic pro cess	IEA	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043517	positive regulation of DN A damage response, signal transduction by p53 clas s mediator	IMP	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0045141	meiotic telomere clusteri ng	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046983	protein dimerization acti vity	IDA	molecular_function
GO:0047485	protein N-terminus bindin g	IDA	molecular_function
GO:0048599	oocyte development	IEA	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0071044	histone mRNA catabolic pr ocess	IDA	biological_process
GO:0071480	cellular response to gamm a radiation	IDA	biological_process
GO:0071500	cellular response to nitr osative stress	IDA	biological_process
GO:0072434	signal transduction invol ved in mitotic G2 DNA dam age checkpoint	IMP	biological_process
GO:0090399	replicative senescence	IEA	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:0097694	establishment of RNA loca lization to telomere	IMP	biological_process
GO:0097695	establishment of macromol ecular complex localizati on to telomere	IC	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901216	positive regulation of ne uron death	IEA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1904262	negative regulation of TO RC1 signaling	IMP	biological_process
GO:1904354	negative regulation of te lomere capping	IMP	biological_process
GO:1904358	positive regulation of te lomere maintenance via te lomere lengthening	IMP	biological_process
GO:1904358	positive regulation of te lomere maintenance via te lomere lengthening	IMP	biological_process
GO:1904884	positive regulation of te lomerase catalytic core c omplex assembly	IMP	biological_process
GO:1990391	DNA repair complex	IDA	cellular_component
GO:0051972	regulation of telomerase activity	IMP	biological_process
GO:0000781	chromosome, telomeric reg ion	IDA	cellular_component
GO:0000784	nuclear chromosome, telom eric region	IC	cellular_component
GO:0000729	DNA double-strand break p rocessing	TAS	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0002331	pre-B cell allelic exclus ion	ISS	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004677	DNA-dependent protein kin ase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	IBA	biological_process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006975	DNA damage induced protei n phosphorylation	IDA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	IGI	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological_process
GO:0007131	reciprocal meiotic recomb ination	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0010212	response to ionizing radi ation	IDA	biological_process
GO:0010212	response to ionizing radi ation	IDA	biological_process
GO:0010506	regulation of autophagy	IMP	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	IMP	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0030889	negative regulation of B cell proliferation	IMP	biological_process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	ISS	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0036289	peptidyl-serine autophosp horylation	IMP	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043517	positive regulation of DN A damage response, signal transduction by p53 clas s mediator	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046983	protein dimerization acti vity	IDA	molecular_function
GO:0047485	protein N-terminus bindin g	IDA	molecular_function
GO:0071044	histone mRNA catabolic pr ocess	IDA	biological_process
GO:0071480	cellular response to gamm a radiation	IDA	biological_process
GO:0071500	cellular response to nitr osative stress	IDA	biological_process
GO:0072434	signal transduction invol ved in mitotic G2 DNA dam age checkpoint	IMP	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:0097694	establishment of RNA loca lization to telomere	IMP	biological_process
GO:0097695	establishment of macromol ecular complex localizati on to telomere	IC	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1904262	negative regulation of TO RC1 signaling	IMP	biological_process
GO:1904354	negative regulation of te lomere capping	IMP	biological_process
GO:1904358	positive regulation of te lomere maintenance via te lomere lengthening	IMP	biological_process
GO:1904358	positive regulation of te lomere maintenance via te lomere lengthening	IMP	biological_process
GO:1904884	positive regulation of te lomerase catalytic core c omplex assembly	IMP	biological_process
GO:1990391	DNA repair complex	IDA	cellular_component
GO:0051972	regulation of telomerase activity	IMP	biological_process
GO:0000781	chromosome, telomeric reg ion	IDA	cellular_component
GO:0000784	nuclear chromosome, telom eric region	IC	cellular_component

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04210  Apoptosis
hsa04110  Cell cycle
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04115  p53 signaling pathway
hsa03440  Homologous recombination
PTHR11139:SF69  p53 pathway feedback loops 2
PTHR11139:SF72  p53 pathway feedback loops 2

Diseases

Associated diseases	References
Ataxia	KEGG: H00064
Cancer	PMID: 12149228
Chronic lymphocytic leukemia	KEGG: H00005
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometrial cancer	PMID: 25608836
Endometriosis	PMID: 24571615
Endometriosis	PMID: 25912412
Hodgkin disease	PMID: 12969974
Hypertension	PMID: 11165203
Idiopathic nonobstructive azoospermia	PMID: 23993922
Polycystic ovary syndrome (PCOS)	PMID: 24169251
Schizophrenia	PMID: 19115993
Endometriosis	INFBASE25912412

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25912412	Endometrio sis			179 (59 endomet rioid cancers, 36 clear cell c ases, 18 contig uous endometrio sis cases, 66 b enign endometri otic ovarian cy sts)		BAF250a AKT ?H2AX BIM BAX ATM CHK2 Bcl2	Show abstract