Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 4790
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol NFKB1   Gene   UCSC   Ensembl
Aliases CVID12, EBP-1, KBF1, NF-kB1, NF-kappa-B, NF-kappaB, NFKB-p105, NFKB-p50, NFkappaB, p105, p50
Gene name nuclear factor kappa B subunit 1
Alternate names nuclear factor NF-kappa-B p105 subunit, DNA-binding factor KBF1, NF-kappabeta, nuclear factor NF-kappa-B p50 subunit, nuclear factor kappa-B DNA binding subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1,
Gene location 4q24 (102501328: 102617301)     Exons: 26     NC_000004.12
Gene summary(Entrez) This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Alternative splicing results in multiple transcript variants encoding different isoforms, at least one of which is proteolytically processed. [provided by RefSeq, Feb 2016]
OMIM 164011

SNPs

rs28362491

Strand:    Allele origin:   Allele change: -/ATTG   Mutation type: in-del

CM000666.2   g.102500998_102501001delATTG
NC_000004.11   g.103422155_103422158delATTG
NC_000004.12   g.102500998_102501001delATTG
NG_050628.1   g.4670_4673delATTG
NM_001165412.1   c.-798_-795delATTG
NM_001319226.1   c.-1177_-1174delATTG
NM_003998.3   c.-798_-795delATTG
NR_136202.1   n.48+1438_48+1441delCAAT

Protein Summary

Protein general information P19838  

Name: Nuclear factor NF kappa B p105 subunit (DNA binding factor KBF1) (EBP 1) (Nuclear factor of kappa light polypeptide gene enhancer in B cells 1) [Cleaved into: Nuclear factor NF kappa B p50 subunit]

Length: 968  Mass: 105,356

Sequence MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSE
KNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVF
ETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTG
SFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFG
GGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSD
DKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDV
KMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGA
DVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENF
EPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEI
PDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI
Structural information
Protein Domains
RHD. (42-367)
Death. (805-892)

Motifs
Nuclear localization(360-365)
Interpro:  IPR002110 IPR020683 IPR011029 IPR000488 IPR013783 IPR014756 IPR002909 IPR033926 IPR030503 IPR000451 IPR008967 IPR030492 IPR032397 IPR011539
Prosite:   PS50297 PS50088 PS01204 PS50254

Pfam:  
PF12796 PF00531 PF16179 PF00554
CDD:   cd01177

PDB:  
1MDI 1MDJ 1MDK 1NFI 1SVC 2DBF 2O61 3GUT
PDBsum:   1MDI 1MDJ 1MDK 1NFI 1SVC 2DBF 2O61 3GUT

DIP:  
106
MINT:   85658
STRING:   ENSP00000226574;
Other Databases GeneCards:  NFKB1;  Malacards:  NFKB1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IC biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IGI biological_process
GO:0000975 regulatory region DNA bin
ding
IDA molecular_function
GO:0000976 transcription regulatory
region sequence-specific
DNA binding
IDA molecular_function
GO:0000977 RNA polymerase II regulat
ory region sequence-speci
fic DNA binding
IDA molecular_function
GO:0000980 RNA polymerase II distal
enhancer sequence-specifi
c DNA binding
IDA molecular_function
GO:0001205 transcriptional activator
activity, RNA polymerase
II distal enhancer seque
nce-specific binding
IDA molecular_function
GO:0001227 transcriptional repressor
activity, RNA polymerase
II transcription regulat
ory region sequence-speci
fic binding
IDA molecular_function
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological_process
GO:0003682 chromatin binding
IBA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005739 mitochondrion
IDA cellular_component
GO:0005829 cytosol
IBA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006366 transcription from RNA po
lymerase II promoter
TAS biological_process
GO:0006915 apoptotic process
IEA biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006979 response to oxidative str
ess
IEA biological_process
GO:0007249 I-kappaB kinase/NF-kappaB
signaling
IBA biological_process
GO:0008134 transcription factor bind
ing
IDA molecular_function
GO:0010744 positive regulation of ma
crophage derived foam cel
l differentiation
IC biological_process
GO:0010884 positive regulation of li
pid storage
IC biological_process
GO:0010956 negative regulation of ca
lcidiol 1-monooxygenase a
ctivity
IDA biological_process
GO:0010957 negative regulation of vi
tamin D biosynthetic proc
ess
IC biological_process
GO:0031072 heat shock protein bindin
g
IEA molecular_function
GO:0031293 membrane protein intracel
lular domain proteolysis
TAS biological_process
GO:0032269 negative regulation of ce
llular protein metabolic
process
IC biological_process
GO:0032375 negative regulation of ch
olesterol transport
IC biological_process
GO:0032481 positive regulation of ty
pe I interferon productio
n
TAS biological_process
GO:0033256 I-kappaB/NF-kappaB comple
x
TAS cellular_component
GO:0035994 response to muscle stretc
h
IEA biological_process
GO:0038061 NIK/NF-kappaB signaling
IBA biological_process
GO:0038095 Fc-epsilon receptor signa
ling pathway
TAS biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0042802 identical protein binding
IPI molecular_function
GO:0042802 identical protein binding
IPI molecular_function
GO:0042803 protein homodimerization
activity
IEA molecular_function
GO:0042805 actinin binding
IPI molecular_function
GO:0043005 neuron projection
IEA cellular_component
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0044212 transcription regulatory
region DNA binding
IDA molecular_function
GO:0045083 negative regulation of in
terleukin-12 biosynthetic
process
IEA biological_process
GO:0045087 innate immune response
IBA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0046688 response to copper ion
IEA biological_process
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0050728 negative regulation of in
flammatory response
IEA biological_process
GO:0050852 T cell receptor signaling
pathway
TAS biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
TAS biological_process
GO:0051403 stress-activated MAPK cas
cade
TAS biological_process
GO:0071222 cellular response to lipo
polysaccharide
IMP biological_process
GO:0071260 cellular response to mech
anical stimulus
IEP biological_process
GO:0071316 cellular response to nico
tine
IMP biological_process
GO:0071322 cellular response to carb
ohydrate stimulus
IEA biological_process
GO:0071347 cellular response to inte
rleukin-1
IEP biological_process
GO:0071354 cellular response to inte
rleukin-6
IMP biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IEA biological_process
GO:0071359 cellular response to dsRN
A
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
IMP biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IMP biological_process
GO:1900127 positive regulation of hy
aluronan biosynthetic pro
cess
IDA biological_process
GO:1904630 cellular response to dite
rpene
IEA biological_process
GO:1904632 cellular response to gluc
oside
IEA biological_process
GO:1990416 cellular response to brai
n-derived neurotrophic fa
ctor stimulus
IEA biological_process
GO:2000630 positive regulation of mi
RNA metabolic process
IMP biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IC biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IGI biological_process
GO:0000975 regulatory region DNA bin
ding
IDA molecular_function
GO:0000976 transcription regulatory
region sequence-specific
DNA binding
IEA molecular_function
GO:0000976 transcription regulatory
region sequence-specific
DNA binding
IDA molecular_function
GO:0000977 RNA polymerase II regulat
ory region sequence-speci
fic DNA binding
IDA molecular_function
GO:0000980 RNA polymerase II distal
enhancer sequence-specifi
c DNA binding
IDA molecular_function
GO:0001205 transcriptional activator
activity, RNA polymerase
II distal enhancer seque
nce-specific binding
IDA molecular_function
GO:0001227 transcriptional repressor
activity, RNA polymerase
II transcription regulat
ory region sequence-speci
fic binding
IDA molecular_function
GO:0001818 negative regulation of cy
tokine production
IEA biological_process
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological_process
GO:0003677 DNA binding
IEA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0003682 chromatin binding
IEA molecular_function
GO:0003682 chromatin binding
IBA molecular_function
GO:0003690 double-stranded DNA bindi
ng
IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
TAS cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005739 mitochondrion
IDA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005829 cytosol
IBA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
IEA biological_process
GO:0006366 transcription from RNA po
lymerase II promoter
TAS biological_process
GO:0006915 apoptotic process
IEA biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006979 response to oxidative str
ess
IEA biological_process
GO:0007165 signal transduction
IEA biological_process
GO:0007249 I-kappaB kinase/NF-kappaB
signaling
IBA biological_process
GO:0008134 transcription factor bind
ing
IDA molecular_function
GO:0009617 response to bacterium
IEA biological_process
GO:0010628 positive regulation of ge
ne expression
IEA biological_process
GO:0010744 positive regulation of ma
crophage derived foam cel
l differentiation
IC biological_process
GO:0010884 positive regulation of li
pid storage
IC biological_process
GO:0010956 negative regulation of ca
lcidiol 1-monooxygenase a
ctivity
IDA biological_process
GO:0010957 negative regulation of vi
tamin D biosynthetic proc
ess
IC biological_process
GO:0014070 response to organic cycli
c compound
IEA biological_process
GO:0031072 heat shock protein bindin
g
IEA molecular_function
GO:0031293 membrane protein intracel
lular domain proteolysis
TAS biological_process
GO:0032269 negative regulation of ce
llular protein metabolic
process
IC biological_process
GO:0032375 negative regulation of ch
olesterol transport
IC biological_process
GO:0032481 positive regulation of ty
pe I interferon productio
n
TAS biological_process
GO:0033256 I-kappaB/NF-kappaB comple
x
TAS cellular_component
GO:0035994 response to muscle stretc
h
IEA biological_process
GO:0038061 NIK/NF-kappaB signaling
IBA biological_process
GO:0038095 Fc-epsilon receptor signa
ling pathway
TAS biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0042802 identical protein binding
IPI molecular_function
GO:0042802 identical protein binding
IPI molecular_function
GO:0042803 protein homodimerization
activity
IEA molecular_function
GO:0042805 actinin binding
IPI molecular_function
GO:0043005 neuron projection
IEA cellular_component
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0043234 protein complex
IEA cellular_component
GO:0043565 sequence-specific DNA bin
ding
IEA molecular_function
GO:0044212 transcription regulatory
region DNA binding
IDA molecular_function
GO:0045083 negative regulation of in
terleukin-12 biosynthetic
process
IEA biological_process
GO:0045087 innate immune response
IBA biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IEA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0046688 response to copper ion
IEA biological_process
GO:0046982 protein heterodimerizatio
n activity
IEA molecular_function
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0050728 negative regulation of in
flammatory response
IEA biological_process
GO:0050852 T cell receptor signaling
pathway
TAS biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
TAS biological_process
GO:0051403 stress-activated MAPK cas
cade
TAS biological_process
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0071222 cellular response to lipo
polysaccharide
IMP biological_process
GO:0071260 cellular response to mech
anical stimulus
IEP biological_process
GO:0071316 cellular response to nico
tine
IMP biological_process
GO:0071322 cellular response to carb
ohydrate stimulus
IEA biological_process
GO:0071347 cellular response to inte
rleukin-1
IEA biological_process
GO:0071347 cellular response to inte
rleukin-1
IEP biological_process
GO:0071354 cellular response to inte
rleukin-6
IMP biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IEA biological_process
GO:0071359 cellular response to dsRN
A
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
IMP biological_process
GO:0071407 cellular response to orga
nic cyclic compound
IEA biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IMP biological_process
GO:1900127 positive regulation of hy
aluronan biosynthetic pro
cess
IDA biological_process
GO:1901653 cellular response to pept
ide
IEA biological_process
GO:1904630 cellular response to dite
rpene
IEA biological_process
GO:1904632 cellular response to gluc
oside
IEA biological_process
GO:1990416 cellular response to brai
n-derived neurotrophic fa
ctor stimulus
IEA biological_process
GO:2000630 positive regulation of mi
RNA metabolic process
IMP biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IC biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IGI biological_process
GO:0000975 regulatory region DNA bin
ding
IDA molecular_function
GO:0000976 transcription regulatory
region sequence-specific
DNA binding
IDA molecular_function
GO:0000977 RNA polymerase II regulat
ory region sequence-speci
fic DNA binding
IDA molecular_function
GO:0000980 RNA polymerase II distal
enhancer sequence-specifi
c DNA binding
IDA molecular_function
GO:0001205 transcriptional activator
activity, RNA polymerase
II distal enhancer seque
nce-specific binding
IDA molecular_function
GO:0001227 transcriptional repressor
activity, RNA polymerase
II transcription regulat
ory region sequence-speci
fic binding
IDA molecular_function
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological_process
GO:0003682 chromatin binding
IBA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
TAS cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005739 mitochondrion
IDA cellular_component
GO:0005829 cytosol
IBA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006366 transcription from RNA po
lymerase II promoter
TAS biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0007249 I-kappaB kinase/NF-kappaB
signaling
IBA biological_process
GO:0008134 transcription factor bind
ing
IDA molecular_function
GO:0010744 positive regulation of ma
crophage derived foam cel
l differentiation
IC biological_process
GO:0010884 positive regulation of li
pid storage
IC biological_process
GO:0010956 negative regulation of ca
lcidiol 1-monooxygenase a
ctivity
IDA biological_process
GO:0010957 negative regulation of vi
tamin D biosynthetic proc
ess
IC biological_process
GO:0031293 membrane protein intracel
lular domain proteolysis
TAS biological_process
GO:0032269 negative regulation of ce
llular protein metabolic
process
IC biological_process
GO:0032375 negative regulation of ch
olesterol transport
IC biological_process
GO:0032481 positive regulation of ty
pe I interferon productio
n
TAS biological_process
GO:0033256 I-kappaB/NF-kappaB comple
x
TAS cellular_component
GO:0038061 NIK/NF-kappaB signaling
IBA biological_process
GO:0038095 Fc-epsilon receptor signa
ling pathway
TAS biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0042802 identical protein binding
IPI molecular_function
GO:0042802 identical protein binding
IPI molecular_function
GO:0042805 actinin binding
IPI molecular_function
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0044212 transcription regulatory
region DNA binding
IDA molecular_function
GO:0045087 innate immune response
IBA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0050852 T cell receptor signaling
pathway
TAS biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
TAS biological_process
GO:0051403 stress-activated MAPK cas
cade
TAS biological_process
GO:0071222 cellular response to lipo
polysaccharide
IMP biological_process
GO:0071260 cellular response to mech
anical stimulus
IEP biological_process
GO:0071316 cellular response to nico
tine
IMP biological_process
GO:0071347 cellular response to inte
rleukin-1
IEP biological_process
GO:0071354 cellular response to inte
rleukin-6
IMP biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
IMP biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IMP biological_process
GO:1900127 positive regulation of hy
aluronan biosynthetic pro
cess
IDA biological_process
GO:2000630 positive regulation of mi
RNA metabolic process
IMP biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa05164  Influenza A
hsa05145  Toxoplasmosis
hsa05202  Transcriptional misregulation in cancer
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa05142  Chagas disease
hsa05215  Prostate cancer
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa05321  Inflammatory bowel disease
hsa04722  Neurotrophin signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa04660  T cell receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa05222  Small cell lung cancer
hsa04917  Prolactin signaling pathway
hsa05133  Pertussis
hsa04064  NF-kappa B signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa05134  Legionellosis
hsa05132  Salmonella infection
hsa04071  Sphingolipid signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05221  Acute myeloid leukemia
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04662  B cell receptor signaling pathway
hsa05131  Shigellosis
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa01523  Antifolate resistance
hsa05030  Cocaine addiction

Diseases

Associated diseases References
Alzheimer's disease PMID: 19141999
Ankylosing spondylitis PMID: 16206345
Behcet's disease PMID: 18616724
Biliary primary cirrhosis PMID: 21399635
Cancer PMID: 16387424
Cardiomyopathy PMID: 16465659
Celiac disease PMID: 16635909
Chronic obstructive pulmonary disease (COPD) PMID: 19625176
Crohn's disease PMID: 13680285
Dermatitis PMID: 17117949
Diabetes PMID: 19070859
Ectopic endometriosis PMID: 18710704
Endometriosis PMID: 24133578
Endometriosis PMID: 20218898
HELLP syndrome PMID: 23905607
Hydrosalpinx PMID: 23061681
Implantation failure PMID: 19955102
Inflammatory bowel disease PMID: 17538633
Endometriosis INFBASE24901401
Female infertility INFBASE22902396
Ectopic endometriosis INFBASE18710704
Peritoneal endometriosis INFBASE17483545
Parkinson's disease PMID: 12203044
Peritoneal endometriosis PMID: 17483545
Peritoneal endometriosis PMID: 17483545
Polycystic ovary syndrome (PCOS) PMID: 17205306
Psoriasis PMID: 16142871
Rheumatoid arthritis PMID: 16476711
Sarcoidosis PMID: 12944982
Schizophrenia PMID: 22479419
Silicosis PMID: 18666137
Ulcerative colitis PMID: 14613970

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24901401 Endometrio
sis

39 cases of the
ectopic endome
trial tissues w
ithin the fallo
pian tubes
Cox-2
NF-KB
VEGF
Show abstract
22196717 Endometrio
sis

48 (24 healthy
women, 24 endom
etriosis patien
ts)
NF-KB1
NF-KB-p65
Show abstract
18710704 Endometrio
sis

9 women with en
dometriotic les
ions
NF-kappaB
Show abstract
15958314 Endometrio
sis

159 (35 specime
ns of normal en
dometrium, 48 e
utopic endometr
ium of endometr
iosis, 76 ectop
ic endometrium)
NF-kappaB
VEGF
Show abstract
17483545 Endometrio
sis (Perit
oneal)

36 biopsies of
peritoneal endo
metriotic lesio
ns
NF-kappaB
Show abstract
20218898 Endometrio
sis
NFKB1(-94 insertion/deletion ATTG polymorphism)
571 (206 women
with endometrio
sis, 365 ethnic
ity-matched hea
lthy control wo
men)
NFKB1
Show abstract
22902396 Endometrio
sis
rs28362491 (-94 insertion/deletion ATTG polymorphism)
438 (172 infert
ile women with
endometriosis,
77 women with i
diopathic infer
tility and 189
controls)
Female infertility
Show abstract