Endometriosis Knowledgebase

Search Result

Gene id

4791

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NFKB2 Gene UCSC Ensembl

Aliases

CVID10, H2TF1, LYT-10, LYT10, NF-kB2, p100, p49/p100, p52

Gene name

nuclear factor kappa B subunit 2

Alternate names

nuclear factor NF-kappa-B p100 subunit, DNA-binding factor KBF2, NFKB, p52/p100 subunit, lymphocyte translocation chromosome 10 protein, nuclear factor Kappa-B, subunit 2, nuclear factor NF-kappa-B p52 subunit, nuclear factor of Kappa light chain gene enhancer ,

Gene location

10q24.32 (102394109: 102402528) Exons: 25 NC_000010.11

Gene summary(Entrez)

This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

OMIM

164012

Protein Summary

Protein general information

Q00653

Name: Nuclear factor NF kappa B p100 subunit (DNA binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B cells 2) (Oncogene Lyt 10) (Lyt10) [Cleaved into: Nuclear factor NF kap

Length: 900 Mass: 96,749

Sequence

MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRK
TYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTM
IQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGA
SNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGS
LGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARL
FGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNH
LHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLA
AGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAA
QNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAG
GDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH

Structural information

Protein Domains	RHD. (38-343) Death. (764-851)
Motifs	Nuclear localization(337-341)
Interpro:	IPR002110 IPR020683 IPR011029 IPR000488 IPR013783 IPR014756 IPR002909 IPR033926 IPR000451 IPR008967 IPR030492 IPR032397 IPR011539
Prosite:	PS50297 PS50088 PS01204 PS50254
Pfam:	PF12796 PF00531 PF16179 PF00554
CDD:	cd01177
PDB:	1A3Q 2D96 3DO7 4OT9
PDBsum:	1A3Q 2D96 3DO7 4OT9
DIP:	24239 27535
MINT:	7944680
STRING:	ENSP00000358983;

Other Databases

GeneCards: NFKB2; Malacards: NFKB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0002268	follicular dendritic cell differentiation	IEA	biological_process
GO:0002467	germinal center formation	IEA	biological_process
GO:0003682	chromatin binding	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033257	Bcl3/NF-kappaB2 complex	IDA	cellular_component
GO:0034097	response to cytokine	IBA	biological_process
GO:0038061	NIK/NF-kappaB signaling	IBA	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048511	rhythmic process	IEA	biological_process
GO:0048536	spleen development	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0002268	follicular dendritic cell differentiation	IEA	biological_process
GO:0002467	germinal center formation	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033257	Bcl3/NF-kappaB2 complex	IDA	cellular_component
GO:0034097	response to cytokine	IEA	biological_process
GO:0034097	response to cytokine	IBA	biological_process
GO:0038061	NIK/NF-kappaB signaling	IEA	biological_process
GO:0038061	NIK/NF-kappaB signaling	IEA	biological_process
GO:0038061	NIK/NF-kappaB signaling	IBA	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048511	rhythmic process	IEA	biological_process
GO:0048536	spleen development	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0003682	chromatin binding	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological_process
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological_process
GO:0033257	Bcl3/NF-kappaB2 complex	IDA	cellular_component
GO:0034097	response to cytokine	IBA	biological_process
GO:0038061	NIK/NF-kappaB signaling	IBA	biological_process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa04010  MAPK signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05224  Breast cancer
hsa05203  Viral carcinogenesis
hsa04380  Osteoclast differentiation
hsa04064  NF-kappa B signaling pathway
hsa05134  Legionellosis

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 16385451
Cancer	PMID: 19573080
Endometriosis	PMID: 19129371
Immunodeficiency	OMIM: 164012
Endometriosis	INFBASE19129371
Rheumatoid arthritis	PMID: 18434448

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19129371	Endometrio sis			79 (37 women wi th endometriosi s, 42 fertile w omen during lap aroscopy)	Female infertility	NFKB	Show abstract