Endometriosis Knowledgebase

Search Result

Gene id

4803

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NGF Gene UCSC Ensembl

Aliases

Beta-NGF, HSAN5, NGFB

Gene name

nerve growth factor

Alternate names

beta-nerve growth factor, nerve growth factor (beta polypeptide), nerve growth factor, beta subunit,

Gene location

1p13.2 (115338252: 115285914) Exons: 4 NC_000001.11

Gene summary(Entrez)

This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008]

OMIM

162030

Protein Summary

Protein general information

P01138

Name: Beta nerve growth factor (Beta NGF)

Length: 241 Mass: 26,959

Sequence

MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPR
LFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTAT
DIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRI
DTACVCVLSRKAVRRA

Structural information

Interpro:	IPR029034 IPR020408 IPR002072 IPR020425 IPR020437 IPR019846
Prosite:	PS00248 PS50270
Pfam:	PF00243
PDB:	1SG1 1WWW 2IFG 4EDW 4EDX 4ZBN 5JZ7
PDBsum:	1SG1 1WWW 2IFG 4EDW 4EDX 4ZBN 5JZ7
DIP:	5712
MINT:	122414
STRING:	ENSP00000358525;

Other Databases

GeneCards: NGF; Malacards: NGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activ ity	TAS	biological_process
GO:0005163	nerve growth factor recep tor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0007018	microtubule-based movemen t	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IBA	biological_process
GO:0008083	growth factor activity	IBA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	IDA	molecular_function
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0032455	nerve growth factor proce ssing	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	TAS	biological_process
GO:0043281	regulation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IBA	biological_process
GO:0045664	regulation of neuron diff erentiation	IBA	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048812	neuron projection morphog enesis	IDA	biological_process
GO:0050772	positive regulation of ax onogenesis	TAS	biological_process
GO:0000186	activation of MAPKK activ ity	TAS	biological_process
GO:0004857	enzyme inhibitor activity	IEA	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005163	nerve growth factor recep tor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0007018	microtubule-based movemen t	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IBA	biological_process
GO:0008083	growth factor activity	IBA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	IEA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	IDA	molecular_function
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IDA	biological_process
GO:0010466	negative regulation of pe ptidase activity	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0030414	peptidase inhibitor activ ity	IEA	molecular_function
GO:0032455	nerve growth factor proce ssing	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	TAS	biological_process
GO:0043281	regulation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IBA	biological_process
GO:0045664	regulation of neuron diff erentiation	IBA	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048812	neuron projection morphog enesis	IDA	biological_process
GO:0050772	positive regulation of ax onogenesis	TAS	biological_process
GO:0000186	activation of MAPKK activ ity	TAS	biological_process
GO:0005163	nerve growth factor recep tor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005768	endosome	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0007018	microtubule-based movemen t	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IBA	biological_process
GO:0008083	growth factor activity	IBA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	IDA	molecular_function
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0032455	nerve growth factor proce ssing	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	TAS	biological_process
GO:0043281	regulation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IBA	biological_process
GO:0045664	regulation of neuron diff erentiation	IBA	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048812	neuron projection morphog enesis	IDA	biological_process
GO:0050772	positive regulation of ax onogenesis	TAS	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04210  Apoptosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 18780967
Asthenozoospermia	PMID: 20542022
Atopic dermatitis	PMID: 19038326
Attention-deficit hyperactivity disorder (ADHD)	PMID: 18179783
Autism	PMID: 19598235
Diminished ovarian reserve (DOR)	PMID: 18222435
Endometriosis	PMID: 20001709
Female infertility	PMID: 22197602
Hereditary sensory and autonomic neuropathy	PMID: 19651702
Male infertility	PMID: 23971410
Multiple sclerosis	PMID: 18563468
Neuropathy	KEGG: H00265, OMIM: 162030
Oligoasthenozoospermia	PMID: 20542022
Ovarian endometriosis	PMID: 12093857
Adenomyotic nodules	INFBASE12093857
Endometriosis	INFBASE26604067
Ovarian endometriosis	PMID: 12093857
Ovarian endometriosis	INFBASE12093857
Peritoneal endometriosis	INFBASE12093857
Peritoneal endometriosis	PMID: 12093857
Peritoneal endometriosis	PMID: 12093857
Psychiatric disorders	PMID: 19086053
Spermatogenetic defects	PMID: 25418418

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
20001709	Endometrio sis		activin A Smad7 NGF-beta	Show abstract
12093857	Endometrio sis (Perit oneal or o varian)	79 (51 patients presenting wit h pain, 28 pati ents with perit oneal and/or ov arian endometri osis but withou t deep adenomyo tic nodule)	NGF	Show abstract
26604067	Endometrio sis	70 (30 healthy controls, 40 wo men with endome triosis)	NGF MAP-2 and SYP	Show abstract