Endometriosis Knowledgebase

Search Result

Gene id

4851

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NOTCH1 Gene UCSC Ensembl

Aliases

AOS5, AOVD1, TAN1, hN1

Gene name

notch 1

Alternate names

neurogenic locus notch homolog protein 1, Notch homolog 1, translocation-associated, translocation-associated notch protein TAN-1,

Gene location

9q34.3 (136545785: 136494432) Exons: 34 NC_000009.12

Gene summary(Entrez)

This gene encodes a member of the NOTCH family of proteins. Members of this Type I transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple different domain types. Notch signaling is an evolutionarily conserved intercellular signaling pathway that regulates interactions between physically adjacent cells through binding of Notch family receptors to their cognate ligands. The encoded preproprotein is proteolytically processed in the trans-Golgi network to generate two polypeptide chains that heterodimerize to form the mature cell-surface receptor. This receptor plays a role in the development of numerous cell and tissue types. Mutations in this gene are associated with aortic valve disease, Adams-Oliver syndrome, T-cell acute lymphoblastic leukemia, chronic lymphocytic leukemia, and head and neck squamous cell carcinoma. [provided by RefSeq, Jan 2016]

OMIM

190198

Protein Summary

Protein general information

P46531

Name: Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation associated notch protein TAN 1) [Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)]

Length: 2555 Mass: 272,505

Tissue specificity: In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues.

Sequence

MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCH
VVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCA
NGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPS
PCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDA
CISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCE
IDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLC
QYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMC
NINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNC
DINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGAT
CEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGF
SGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQG
YTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDA
GNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNP
CDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDAR
TCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLC
HILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLV
VVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKA
SLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSET
VEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVN
VRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEA
SADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVD
DLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACGSKEAKD
LKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDTHLGIGHLNVA
AKPEMAALGGGGRLAFETGPPRLSHLPVASGTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNP
LRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA
NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPP
VTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARI
PEAFK

Structural information

Protein Domains	EGF-like (20-58) EGF-like (59-99) EGF-like (102-139) EGF-like (140-176)
Interpro:	IPR002110 IPR020683 IPR024600 IPR001881 IPR013032 IPR000742 IPR000152 IPR018097 IPR009030 IPR008297 IPR022362 IPR000800 IPR010660 IPR011656
Prosite:	PS50297 PS50088 PS00010 PS00022 PS01186 PS50026 PS01187 PS50258
Pfam:	PF12796 PF11936 PF00008 PF07645 PF12661 PF06816 PF07684 PF00066
PDB:	1PB5 1TOZ 1YYH 2F8X 2F8Y 2HE0 2VJ3 3ETO 3I08 3L95 3NBN 3V79 4CUD 4CUE 4CUF 4D0E 4D0F 5FM9 5FMA
PDBsum:	1PB5 1TOZ 1YYH 2F8X 2F8Y 2HE0 2VJ3 3ETO 3I08 3L95 3NBN 3V79 4CUD 4CUE 4CUF 4D0E 4D0F 5FM9 5FMA
DIP:	29919
MINT:	1417018
STRING:	ENSP00000277541;

Other Databases

GeneCards: NOTCH1; Malacards: NOTCH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001047	core promoter binding	ISS	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	ISS	molecular_function
GO:0001669	acrosomal vesicle	IEA	cellular_component
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001708	cell fate specification	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	ISS	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001947	heart looping	ISS	biological_process
GO:0002040	sprouting angiogenesis	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002193	MAML1-RBP-Jkappa- ICN1 co mplex	IDA	cellular_component
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological_process
GO:0003157	endocardium development	ISS	biological_process
GO:0003160	endocardium morphogenesis	ISS	biological_process
GO:0003162	atrioventricular node dev elopment	IEA	biological_process
GO:0003169	coronary vein morphogenes is	ISS	biological_process
GO:0003180	aortic valve morphogenesi s	IMP	biological_process
GO:0003180	aortic valve morphogenesi s	IMP	biological_process
GO:0003181	atrioventricular valve mo rphogenesis	ISS	biological_process
GO:0003184	pulmonary valve morphogen esis	IMP	biological_process
GO:0003192	mitral valve formation	IMP	biological_process
GO:0003198	epithelial to mesenchymal transition involved in e ndocardial cushion format ion	ISS	biological_process
GO:0003203	endocardial cushion morph ogenesis	ISS	biological_process
GO:0003207	cardiac chamber formation	ISS	biological_process
GO:0003208	cardiac ventricle morphog enesis	ISS	biological_process
GO:0003209	cardiac atrium morphogene sis	ISS	biological_process
GO:0003213	cardiac right atrium morp hogenesis	ISS	biological_process
GO:0003214	cardiac left ventricle mo rphogenesis	ISS	biological_process
GO:0003219	cardiac right ventricle f ormation	IEA	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	ISS	biological_process
GO:0003241	growth involved in heart morphogenesis	ISS	biological_process
GO:0003256	regulation of transcripti on from RNA polymerase II promoter involved in myo cardial precursor cell di fferentiation	ISS	biological_process
GO:0003270	Notch signaling pathway i nvolved in regulation of secondary heart field car dioblast proliferation	IEA	biological_process
GO:0003273	cell migration involved i n endocardial cushion for mation	ISS	biological_process
GO:0003344	pericardium morphogenesis	ISS	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0004857	enzyme inhibitor activity	ISS	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0005112	Notch binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005912	adherens junction	ISS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	TAS	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0006959	humoral immune response	IEA	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	IMP	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007221	positive regulation of tr anscription of Notch rece ptor target	ISS	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007368	determination of left/rig ht symmetry	ISS	biological_process
GO:0007386	compartment pattern speci fication	IEA	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007440	foregut morphogenesis	IEA	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0007507	heart development	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009912	auditory receptor cell fa te commitment	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IMP	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IDA	biological_process
GO:0010832	negative regulation of my otube differentiation	ISS	biological_process
GO:0014031	mesenchymal cell developm ent	ISS	biological_process
GO:0014807	regulation of somitogenes is	IEA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016324	apical plasma membrane	ISS	cellular_component
GO:0019899	enzyme binding	ISS	molecular_function
GO:0021515	cell differentiation in s pinal cord	IEA	biological_process
GO:0021915	neural tube development	IEA	biological_process
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030279	negative regulation of os sification	ISS	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0030513	positive regulation of BM P signaling pathway	ISS	biological_process
GO:0030514	negative regulation of BM P signaling pathway	ISS	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031490	chromatin DNA binding	IEA	molecular_function
GO:0031960	response to corticosteroi d	IEA	biological_process
GO:0032495	response to muramyl dipep tide	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IEA	biological_process
GO:0035148	tube formation	IMP	biological_process
GO:0035914	skeletal muscle cell diff erentiation	IEA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0042246	tissue regeneration	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	ISS	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0045070	positive regulation of vi ral genome replication	IEA	biological_process
GO:0045603	positive regulation of en dothelial cell differenti ation	IEA	biological_process
GO:0045608	negative regulation of au ditory receptor cell diff erentiation	IEA	biological_process
GO:0045618	positive regulation of ke ratinocyte differentiatio n	IEA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IMP	biological_process
GO:0045668	negative regulation of os teoblast differentiation	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045955	negative regulation of ca lcium ion-dependent exocy tosis	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	ISS	biological_process
GO:0046533	negative regulation of ph otoreceptor cell differen tiation	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048103	somatic stem cell divisio n	IEA	biological_process
GO:0048708	astrocyte differentiation	IEA	biological_process
GO:0048709	oligodendrocyte different iation	IEA	biological_process
GO:0048711	positive regulation of as trocyte differentiation	ISS	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	ISS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0050434	positive regulation of vi ral transcription	IEA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050768	negative regulation of ne urogenesis	ISS	biological_process
GO:0055008	cardiac muscle tissue mor phogenesis	ISS	biological_process
GO:0060038	cardiac muscle cell proli feration	IEA	biological_process
GO:0060045	positive regulation of ca rdiac muscle cell prolife ration	ISS	biological_process
GO:0060253	negative regulation of gl ial cell proliferation	ISS	biological_process
GO:0060271	cilium assembly	ISS	biological_process
GO:0060317	cardiac epithelial to mes enchymal transition	ISS	biological_process
GO:0060411	cardiac septum morphogene sis	ISS	biological_process
GO:0060412	ventricular septum morpho genesis	IMP	biological_process
GO:0060528	secretory columnal lumina r epithelial cell differe ntiation involved in pros tate glandular acinus dev elopment	IEA	biological_process
GO:0060740	prostate gland epithelium morphogenesis	IEA	biological_process
GO:0060768	regulation of epithelial cell proliferation involv ed in prostate gland deve lopment	IEA	biological_process
GO:0060842	arterial endothelial cell differentiation	ISS	biological_process
GO:0060843	venous endothelial cell d ifferentiation	ISS	biological_process
GO:0060948	cardiac vascular smooth m uscle cell development	ISS	biological_process
GO:0060956	endocardial cell differen tiation	ISS	biological_process
GO:0060979	vasculogenesis involved i n coronary vascular morph ogenesis	ISS	biological_process
GO:0060982	coronary artery morphogen esis	ISS	biological_process
GO:0061314	Notch signaling involved in heart development	IMP	biological_process
GO:0061314	Notch signaling involved in heart development	IMP	biological_process
GO:0061384	heart trabecula morphogen esis	ISS	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	ISS	biological_process
GO:0070986	left/right axis specifica tion	IEA	biological_process
GO:0071372	cellular response to foll icle-stimulating hormone stimulus	IDA	biological_process
GO:0072017	distal tubule development	IEA	biological_process
GO:0072044	collecting duct developme nt	IEA	biological_process
GO:0072144	glomerular mesangial cell development	IEA	biological_process
GO:0072602	interleukin-4 secretion	IEA	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0097150	neuronal stem cell popula tion maintenance	IEP	biological_process
GO:1901201	regulation of extracellul ar matrix assembly	ISS	biological_process
GO:1902263	apoptotic process involve d in embryonic digit morp hogenesis	IEA	biological_process
GO:2000737	negative regulation of st em cell differentiation	IMP	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2000974	negative regulation of pr o-B cell differentiation	ISS	biological_process
GO:2001027	negative regulation of en dothelial cell chemotaxis	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001047	core promoter binding	IEA	molecular_function
GO:0001047	core promoter binding	ISS	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	IEA	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	ISS	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001669	acrosomal vesicle	IEA	cellular_component
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001708	cell fate specification	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	ISS	biological_process
GO:0001889	liver development	IEA	biological_process
GO:0001947	heart looping	IEA	biological_process
GO:0001947	heart looping	ISS	biological_process
GO:0002040	sprouting angiogenesis	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002193	MAML1-RBP-Jkappa- ICN1 co mplex	IDA	cellular_component
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological_process
GO:0003157	endocardium development	IEA	biological_process
GO:0003157	endocardium development	ISS	biological_process
GO:0003160	endocardium morphogenesis	IEA	biological_process
GO:0003160	endocardium morphogenesis	ISS	biological_process
GO:0003162	atrioventricular node dev elopment	IEA	biological_process
GO:0003169	coronary vein morphogenes is	IEA	biological_process
GO:0003169	coronary vein morphogenes is	ISS	biological_process
GO:0003180	aortic valve morphogenesi s	IMP	biological_process
GO:0003180	aortic valve morphogenesi s	IMP	biological_process
GO:0003181	atrioventricular valve mo rphogenesis	IEA	biological_process
GO:0003181	atrioventricular valve mo rphogenesis	ISS	biological_process
GO:0003184	pulmonary valve morphogen esis	IMP	biological_process
GO:0003192	mitral valve formation	IMP	biological_process
GO:0003197	endocardial cushion devel opment	IEA	biological_process
GO:0003198	epithelial to mesenchymal transition involved in e ndocardial cushion format ion	IEA	biological_process
GO:0003198	epithelial to mesenchymal transition involved in e ndocardial cushion format ion	ISS	biological_process
GO:0003203	endocardial cushion morph ogenesis	IEA	biological_process
GO:0003203	endocardial cushion morph ogenesis	ISS	biological_process
GO:0003207	cardiac chamber formation	IEA	biological_process
GO:0003207	cardiac chamber formation	ISS	biological_process
GO:0003208	cardiac ventricle morphog enesis	IEA	biological_process
GO:0003208	cardiac ventricle morphog enesis	ISS	biological_process
GO:0003209	cardiac atrium morphogene sis	IEA	biological_process
GO:0003209	cardiac atrium morphogene sis	ISS	biological_process
GO:0003213	cardiac right atrium morp hogenesis	IEA	biological_process
GO:0003213	cardiac right atrium morp hogenesis	ISS	biological_process
GO:0003214	cardiac left ventricle mo rphogenesis	IEA	biological_process
GO:0003214	cardiac left ventricle mo rphogenesis	ISS	biological_process
GO:0003219	cardiac right ventricle f ormation	IEA	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	IEA	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	ISS	biological_process
GO:0003241	growth involved in heart morphogenesis	IEA	biological_process
GO:0003241	growth involved in heart morphogenesis	ISS	biological_process
GO:0003256	regulation of transcripti on from RNA polymerase II promoter involved in myo cardial precursor cell di fferentiation	IEA	biological_process
GO:0003256	regulation of transcripti on from RNA polymerase II promoter involved in myo cardial precursor cell di fferentiation	ISS	biological_process
GO:0003264	regulation of cardioblast proliferation	IEA	biological_process
GO:0003270	Notch signaling pathway i nvolved in regulation of secondary heart field car dioblast proliferation	IEA	biological_process
GO:0003273	cell migration involved i n endocardial cushion for mation	IEA	biological_process
GO:0003273	cell migration involved i n endocardial cushion for mation	ISS	biological_process
GO:0003344	pericardium morphogenesis	IEA	biological_process
GO:0003344	pericardium morphogenesis	ISS	biological_process
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0004857	enzyme inhibitor activity	IEA	molecular_function
GO:0004857	enzyme inhibitor activity	ISS	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0005112	Notch binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005912	adherens junction	IEA	cellular_component
GO:0005912	adherens junction	ISS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	TAS	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0006959	humoral immune response	IEA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	IMP	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007221	positive regulation of tr anscription of Notch rece ptor target	IEA	biological_process
GO:0007221	positive regulation of tr anscription of Notch rece ptor target	ISS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007368	determination of left/rig ht symmetry	IEA	biological_process
GO:0007368	determination of left/rig ht symmetry	ISS	biological_process
GO:0007386	compartment pattern speci fication	IEA	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007440	foregut morphogenesis	IEA	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0007507	heart development	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008544	epidermis development	IEA	biological_process
GO:0008593	regulation of Notch signa ling pathway	IEA	biological_process
GO:0009912	auditory receptor cell fa te commitment	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010001	glial cell differentiatio n	IEA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IMP	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IDA	biological_process
GO:0010832	negative regulation of my otube differentiation	IEA	biological_process
GO:0010832	negative regulation of my otube differentiation	ISS	biological_process
GO:0014031	mesenchymal cell developm ent	IEA	biological_process
GO:0014031	mesenchymal cell developm ent	ISS	biological_process
GO:0014807	regulation of somitogenes is	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016324	apical plasma membrane	ISS	cellular_component
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	ISS	molecular_function
GO:0021515	cell differentiation in s pinal cord	IEA	biological_process
GO:0021915	neural tube development	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030182	neuron differentiation	IEA	biological_process
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030279	negative regulation of os sification	IEA	biological_process
GO:0030279	negative regulation of os sification	ISS	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030334	regulation of cell migrat ion	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0030513	positive regulation of BM P signaling pathway	IEA	biological_process
GO:0030513	positive regulation of BM P signaling pathway	ISS	biological_process
GO:0030514	negative regulation of BM P signaling pathway	IEA	biological_process
GO:0030514	negative regulation of BM P signaling pathway	ISS	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031490	chromatin DNA binding	IEA	molecular_function
GO:0031960	response to corticosteroi d	IEA	biological_process
GO:0032495	response to muramyl dipep tide	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IEA	biological_process
GO:0035148	tube formation	IMP	biological_process
GO:0035914	skeletal muscle cell diff erentiation	IEA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042246	tissue regeneration	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	ISS	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0045070	positive regulation of vi ral genome replication	IEA	biological_process
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045603	positive regulation of en dothelial cell differenti ation	IEA	biological_process
GO:0045607	regulation of auditory re ceptor cell differentiati on	IEA	biological_process
GO:0045608	negative regulation of au ditory receptor cell diff erentiation	IEA	biological_process
GO:0045618	positive regulation of ke ratinocyte differentiatio n	IEA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IMP	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	ISS	biological_process
GO:0045687	positive regulation of gl ial cell differentiation	IEA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045955	negative regulation of ca lcium ion-dependent exocy tosis	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	ISS	biological_process
GO:0046533	negative regulation of ph otoreceptor cell differen tiation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048103	somatic stem cell divisio n	IEA	biological_process
GO:0048663	neuron fate commitment	IEA	biological_process
GO:0048708	astrocyte differentiation	IEA	biological_process
GO:0048709	oligodendrocyte different iation	IEA	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0048711	positive regulation of as trocyte differentiation	ISS	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	ISS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0050434	positive regulation of vi ral transcription	IEA	biological_process
GO:0050678	regulation of epithelial cell proliferation	IEA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050767	regulation of neurogenesi s	IEA	biological_process
GO:0050768	negative regulation of ne urogenesis	IEA	biological_process
GO:0050768	negative regulation of ne urogenesis	ISS	biological_process
GO:0050793	regulation of development al process	IEA	biological_process
GO:0055008	cardiac muscle tissue mor phogenesis	IEA	biological_process
GO:0055008	cardiac muscle tissue mor phogenesis	ISS	biological_process
GO:0060038	cardiac muscle cell proli feration	IEA	biological_process
GO:0060045	positive regulation of ca rdiac muscle cell prolife ration	IEA	biological_process
GO:0060045	positive regulation of ca rdiac muscle cell prolife ration	ISS	biological_process
GO:0060253	negative regulation of gl ial cell proliferation	IEA	biological_process
GO:0060253	negative regulation of gl ial cell proliferation	ISS	biological_process
GO:0060271	cilium assembly	ISS	biological_process
GO:0060317	cardiac epithelial to mes enchymal transition	IEA	biological_process
GO:0060317	cardiac epithelial to mes enchymal transition	ISS	biological_process
GO:0060411	cardiac septum morphogene sis	IEA	biological_process
GO:0060411	cardiac septum morphogene sis	ISS	biological_process
GO:0060412	ventricular septum morpho genesis	IMP	biological_process
GO:0060528	secretory columnal lumina r epithelial cell differe ntiation involved in pros tate glandular acinus dev elopment	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0060740	prostate gland epithelium morphogenesis	IEA	biological_process
GO:0060768	regulation of epithelial cell proliferation involv ed in prostate gland deve lopment	IEA	biological_process
GO:0060842	arterial endothelial cell differentiation	IEA	biological_process
GO:0060842	arterial endothelial cell differentiation	ISS	biological_process
GO:0060843	venous endothelial cell d ifferentiation	IEA	biological_process
GO:0060843	venous endothelial cell d ifferentiation	ISS	biological_process
GO:0060948	cardiac vascular smooth m uscle cell development	IEA	biological_process
GO:0060948	cardiac vascular smooth m uscle cell development	ISS	biological_process
GO:0060956	endocardial cell differen tiation	IEA	biological_process
GO:0060956	endocardial cell differen tiation	ISS	biological_process
GO:0060979	vasculogenesis involved i n coronary vascular morph ogenesis	IEA	biological_process
GO:0060979	vasculogenesis involved i n coronary vascular morph ogenesis	ISS	biological_process
GO:0060982	coronary artery morphogen esis	IEA	biological_process
GO:0060982	coronary artery morphogen esis	ISS	biological_process
GO:0061314	Notch signaling involved in heart development	IEA	biological_process
GO:0061314	Notch signaling involved in heart development	IMP	biological_process
GO:0061314	Notch signaling involved in heart development	IMP	biological_process
GO:0061384	heart trabecula morphogen esis	IEA	biological_process
GO:0061384	heart trabecula morphogen esis	ISS	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IEA	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	ISS	biological_process
GO:0070986	left/right axis specifica tion	IEA	biological_process
GO:0071372	cellular response to foll icle-stimulating hormone stimulus	IDA	biological_process
GO:0071944	cell periphery	IEA	cellular_component
GO:0072017	distal tubule development	IEA	biological_process
GO:0072044	collecting duct developme nt	IEA	biological_process
GO:0072144	glomerular mesangial cell development	IEA	biological_process
GO:0072602	interleukin-4 secretion	IEA	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0097150	neuronal stem cell popula tion maintenance	IEP	biological_process
GO:1901201	regulation of extracellul ar matrix assembly	IEA	biological_process
GO:1901201	regulation of extracellul ar matrix assembly	ISS	biological_process
GO:1902263	apoptotic process involve d in embryonic digit morp hogenesis	IEA	biological_process
GO:2000737	negative regulation of st em cell differentiation	IMP	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2000974	negative regulation of pr o-B cell differentiation	IEA	biological_process
GO:2000974	negative regulation of pr o-B cell differentiation	ISS	biological_process
GO:2001027	negative regulation of en dothelial cell chemotaxis	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001047	core promoter binding	ISS	molecular_function
GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	ISS	molecular_function
GO:0001837	epithelial to mesenchymal transition	ISS	biological_process
GO:0001947	heart looping	ISS	biological_process
GO:0002193	MAML1-RBP-Jkappa- ICN1 co mplex	IDA	cellular_component
GO:0003157	endocardium development	ISS	biological_process
GO:0003160	endocardium morphogenesis	ISS	biological_process
GO:0003169	coronary vein morphogenes is	ISS	biological_process
GO:0003180	aortic valve morphogenesi s	IMP	biological_process
GO:0003180	aortic valve morphogenesi s	IMP	biological_process
GO:0003181	atrioventricular valve mo rphogenesis	ISS	biological_process
GO:0003184	pulmonary valve morphogen esis	IMP	biological_process
GO:0003192	mitral valve formation	IMP	biological_process
GO:0003198	epithelial to mesenchymal transition involved in e ndocardial cushion format ion	ISS	biological_process
GO:0003203	endocardial cushion morph ogenesis	ISS	biological_process
GO:0003207	cardiac chamber formation	ISS	biological_process
GO:0003208	cardiac ventricle morphog enesis	ISS	biological_process
GO:0003209	cardiac atrium morphogene sis	ISS	biological_process
GO:0003213	cardiac right atrium morp hogenesis	ISS	biological_process
GO:0003214	cardiac left ventricle mo rphogenesis	ISS	biological_process
GO:0003222	ventricular trabecula myo cardium morphogenesis	ISS	biological_process
GO:0003241	growth involved in heart morphogenesis	ISS	biological_process
GO:0003256	regulation of transcripti on from RNA polymerase II promoter involved in myo cardial precursor cell di fferentiation	ISS	biological_process
GO:0003273	cell migration involved i n endocardial cushion for mation	ISS	biological_process
GO:0003344	pericardium morphogenesis	ISS	biological_process
GO:0004857	enzyme inhibitor activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005912	adherens junction	ISS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	TAS	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007219	Notch signaling pathway	IMP	biological_process
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0007221	positive regulation of tr anscription of Notch rece ptor target	ISS	biological_process
GO:0007368	determination of left/rig ht symmetry	ISS	biological_process
GO:0007507	heart development	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IMP	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IDA	biological_process
GO:0010832	negative regulation of my otube differentiation	ISS	biological_process
GO:0014031	mesenchymal cell developm ent	ISS	biological_process
GO:0016324	apical plasma membrane	ISS	cellular_component
GO:0019899	enzyme binding	ISS	molecular_function
GO:0030279	negative regulation of os sification	ISS	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0030513	positive regulation of BM P signaling pathway	ISS	biological_process
GO:0030514	negative regulation of BM P signaling pathway	ISS	biological_process
GO:0035148	tube formation	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0043086	negative regulation of ca talytic activity	ISS	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0045662	negative regulation of my oblast differentiation	IMP	biological_process
GO:0045668	negative regulation of os teoblast differentiation	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	ISS	biological_process
GO:0048711	positive regulation of as trocyte differentiation	ISS	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	ISS	biological_process
GO:0050768	negative regulation of ne urogenesis	ISS	biological_process
GO:0055008	cardiac muscle tissue mor phogenesis	ISS	biological_process
GO:0060045	positive regulation of ca rdiac muscle cell prolife ration	ISS	biological_process
GO:0060253	negative regulation of gl ial cell proliferation	ISS	biological_process
GO:0060271	cilium assembly	ISS	biological_process
GO:0060317	cardiac epithelial to mes enchymal transition	ISS	biological_process
GO:0060411	cardiac septum morphogene sis	ISS	biological_process
GO:0060412	ventricular septum morpho genesis	IMP	biological_process
GO:0060842	arterial endothelial cell differentiation	ISS	biological_process
GO:0060843	venous endothelial cell d ifferentiation	ISS	biological_process
GO:0060948	cardiac vascular smooth m uscle cell development	ISS	biological_process
GO:0060956	endocardial cell differen tiation	ISS	biological_process
GO:0060979	vasculogenesis involved i n coronary vascular morph ogenesis	ISS	biological_process
GO:0060982	coronary artery morphogen esis	ISS	biological_process
GO:0061314	Notch signaling involved in heart development	IMP	biological_process
GO:0061314	Notch signaling involved in heart development	IMP	biological_process
GO:0061384	heart trabecula morphogen esis	ISS	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	ISS	biological_process
GO:0071372	cellular response to foll icle-stimulating hormone stimulus	IDA	biological_process
GO:0090051	negative regulation of ce ll migration involved in sprouting angiogenesis	IDA	biological_process
GO:0097150	neuronal stem cell popula tion maintenance	IEP	biological_process
GO:1901201	regulation of extracellul ar matrix assembly	ISS	biological_process
GO:2000737	negative regulation of st em cell differentiation	IMP	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2000974	negative regulation of pr o-B cell differentiation	ISS	biological_process
GO:2001027	negative regulation of en dothelial cell chemotaxis	IDA	biological_process

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa05224  Breast cancer
hsa01522  Endocrine resistance
hsa04919  Thyroid hormone signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05020  Prion diseases
hsa04320  Dorso-ventral axis formation
hsa04330  Notch signaling pathway

Diseases

Associated diseases	References
Adams-Oliver syndrome	KEGG: H01413
Bicuspid aortic valve	KEGG: H00554
Cancer	PMID: 16707600
Endometriosis	PMID: 25546156
Female infertility	PMID: 25034535
Endometriosis	INFBASE25546156
T lymphoblastic leukemia	KEGG: H00002

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25546156	Endometrio sis				Female infertility	NOTCH1 NOTCH4 JAGGED2 DLL4 HES5 HEY1	Show abstract