Endometriosis Knowledgebase

Search Result

Gene id

4852

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NPY Gene UCSC Ensembl

Aliases

PYY4

Gene name

neuropeptide Y

Alternate names

pro-neuropeptide Y, prepro-neuropeptide Y,

Gene location

7p15.3 (24284187: 24291864) Exons: 4 NC_000007.14

Gene summary(Entrez)

This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]

OMIM

162640

Protein Summary

Protein general information

P01303

Name: Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)]

Length: 97 Mass: 10,851

Tissue specificity: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Sequence

MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLIS
DLLMRESTENVPRTRLEDPAMW

Structural information

Interpro:	IPR001955 IPR020392
Prosite:	PS00265 PS50276
Pfam:	PF00159
CDD:	cd00126
PDB:	1QFA 1RON
PDBsum:	1QFA 1RON
MINT:
STRING:	ENSP00000242152;

Other Databases

GeneCards: NPY; Malacards: NPY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0001878	response to yeast	IDA	biological_process
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005246	calcium channel regulator activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005623	cell	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006816	calcium ion transport	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007218	neuropeptide signaling pa thway	IBA	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007586	digestion	IBA	biological_process
GO:0007610	behavior	TAS	biological_process
GO:0007631	feeding behavior	TAS	biological_process
GO:0008015	blood circulation	NAS	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008343	adult feeding behavior	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0021954	central nervous system ne uron development	IEP	biological_process
GO:0021987	cerebral cortex developme nt	IEP	biological_process
GO:0031175	neuron projection develop ment	IEP	biological_process
GO:0032098	regulation of appetite	IBA	biological_process
GO:0032100	positive regulation of ap petite	ISS	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0001664	G-protein coupled recepto r binding	IEA	molecular_function
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0001878	response to yeast	IDA	biological_process
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005246	calcium channel regulator activity	TAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005623	cell	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006816	calcium ion transport	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007218	neuropeptide signaling pa thway	IBA	biological_process
GO:0007218	neuropeptide signaling pa thway	IEA	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007586	digestion	IBA	biological_process
GO:0007586	digestion	NAS	biological_process
GO:0007610	behavior	TAS	biological_process
GO:0007631	feeding behavior	TAS	biological_process
GO:0008015	blood circulation	NAS	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008343	adult feeding behavior	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0021954	central nervous system ne uron development	IEP	biological_process
GO:0021987	cerebral cortex developme nt	IEP	biological_process
GO:0031175	neuron projection develop ment	IEP	biological_process
GO:0032098	regulation of appetite	IBA	biological_process
GO:0032100	positive regulation of ap petite	ISS	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0001878	response to yeast	IDA	biological_process
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005246	calcium channel regulator activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005623	cell	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006816	calcium ion transport	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007218	neuropeptide signaling pa thway	IBA	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007586	digestion	IBA	biological_process
GO:0007586	digestion	NAS	biological_process
GO:0007610	behavior	TAS	biological_process
GO:0007631	feeding behavior	TAS	biological_process
GO:0008015	blood circulation	NAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008343	adult feeding behavior	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0021954	central nervous system ne uron development	IEP	biological_process
GO:0021987	cerebral cortex developme nt	IEP	biological_process
GO:0031175	neuron projection develop ment	IEP	biological_process
GO:0032098	regulation of appetite	IBA	biological_process
GO:0032100	positive regulation of ap petite	ISS	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process

KEGG pathways

hsa05034  Alcoholism
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04024  cAMP signaling pathway

Diseases

Associated diseases	References
Seizures	GAD18055304
Schizophrenia	GAD19150389
Schizophrenia	GAD17366345
Schizophrenia	GAD16459651
Schizophrenia	GAD16390370
Schizophrenia	GAD12875921
Retinopathy	GAD12724690
Psychiatric disorders	GAD19086053
Adenocarcinoma	GAD20453000
Apoplexy	GAD20435026
Metabolic syndrome	GAD19056482
Macular degeneration	GAD17305733
Lymphoma	GAD15894681
Hypertension	GAD12646110
Hypercholesterolemia	GAD19846279
Diabetes	GAD20416077
Depression	GAD14757324
Chronic renal failure	GAD20543711
Chorioamnionitis	GAD20452482
Celiac disease	GAD19240061
Cardiovascular Diseases	GAD18974842
Bulimia	GAD20468064
Brain Ischemia	GAD19619519
Autism	GAD19058789
Atherosclerosis	GAD14747236
Endometriosis	PubMed24807378

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
24807378	Endometrio sis		S100 NSE SP VIP �NPY NKA NKB NKR1 NKR2 and NKR3	Show abstract
24685017	Endometrio sis	48 (24 women wi th endometriosi s, 24 women wit h benign gyneco logic diseases)	PGP9.5 VIP and�NPY	Show abstract
18928861	Endometrio sis	49 (20 of them with deep endom etriosis in the uterosacral li gament and 29 p atients without endometriosis)	NSE NPY VIP	Show abstract
27094925	Endometrio sis		PROK-1 integrins ?3?1 ?4?1 ?1 and ?6 Htert CYP19 17?HSD2 ER-? ER-? caldesmon CALD1 PGP 9.5 VIP CGRP SP NPY NF CA-125	Show abstract