Endometriosis Knowledgebase

Search Result

Gene id

4904

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

YBX1 Gene UCSC Ensembl

Aliases

BP-8, CBF-A, CSDA2, CSDB, DBPB, EFI-A, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1

Gene name

Y-box binding protein 1

Alternate names

nuclease-sensitive element-binding protein 1, CCAAT-binding transcription factor I subunit A, DNA-binding protein B, Y-box transcription factor, enhancer factor I subunit A, major histocompatibility complex, class II, Y box-binding protein I,

Gene location

1p34.2 (42682234: 42703802) Exons: 9 NC_000001.11

Gene summary(Entrez)

This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Sep 2015]

OMIM

154030

Protein Summary

Protein general information

P67809

Name: Nuclease sensitive element binding protein 1 (CCAAT binding transcription factor I subunit A) (CBF A) (DNA binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI A) (Y box transcription factor) (Y box binding protein 1) (YB 1)

Length: 324 Mass: 35,924

Sequence

MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFI
NRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPR
RRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQG
AGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE

Structural information

Protein Domains	CSD. (61-125)
Interpro:	IPR019844 IPR011129 IPR002059 IPR012340
Prosite:	PS00352
Pfam:	PF00313
CDD:	cd04458
PDB:	1H95
PDBsum:	1H95
DIP:	29405
MINT:	5001202
STRING:	ENSP00000361626;

Other Databases

GeneCards: YBX1; Malacards: YBX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000398	mRNA splicing, via splice osome	TAS	biological_process
GO:0000398	mRNA splicing, via splice osome	TAS	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003690	double-stranded DNA bindi ng	TAS	molecular_function
GO:0003697	single-stranded DNA bindi ng	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003723	RNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005689	U12-type spliceosomal com plex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0010494	cytoplasmic stress granul e	IDA	cellular_component
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070934	CRD-mediated mRNA stabili zation	IMP	biological_process
GO:0070937	CRD-mediated mRNA stabili ty complex	IDA	cellular_component
GO:0071204	histone pre-mRNA 3'end pr ocessing complex	ISS	cellular_component
GO:1903608	protein localization to c ytoplasmic stress granule	IMP	biological_process
GO:0000398	mRNA splicing, via splice osome	TAS	biological_process
GO:0000398	mRNA splicing, via splice osome	TAS	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003690	double-stranded DNA bindi ng	TAS	molecular_function
GO:0003697	single-stranded DNA bindi ng	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003723	RNA binding	IEA	molecular_function
GO:0003723	RNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005689	U12-type spliceosomal com plex	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0006397	mRNA processing	IEA	biological_process
GO:0008380	RNA splicing	IEA	biological_process
GO:0010494	cytoplasmic stress granul e	IDA	cellular_component
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070934	CRD-mediated mRNA stabili zation	IMP	biological_process
GO:0070937	CRD-mediated mRNA stabili ty complex	IDA	cellular_component
GO:0071204	histone pre-mRNA 3'end pr ocessing complex	ISS	cellular_component
GO:1903608	protein localization to c ytoplasmic stress granule	IMP	biological_process
GO:0000398	mRNA splicing, via splice osome	TAS	biological_process
GO:0000398	mRNA splicing, via splice osome	TAS	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003690	double-stranded DNA bindi ng	TAS	molecular_function
GO:0003697	single-stranded DNA bindi ng	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003723	RNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005689	U12-type spliceosomal com plex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0010494	cytoplasmic stress granul e	IDA	cellular_component
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular_component
GO:0031965	nuclear membrane	IDA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070934	CRD-mediated mRNA stabili zation	IMP	biological_process
GO:0070937	CRD-mediated mRNA stabili ty complex	IDA	cellular_component
GO:0071204	histone pre-mRNA 3'end pr ocessing complex	ISS	cellular_component
GO:1903608	protein localization to c ytoplasmic stress granule	IMP	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 26093350
Endometriosis	INFBASE26093350
Endometriosis	INFBASE22095791

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26093350	Endometrio sis			22 (12 patients with histologi cally confirmed endometriosis, 10 controls)			Show abstract
22095791	Endometrio sis			211 (120 women with endometrio sis, 91 women w ithout endometr iosis)		YB-1	Show abstract