Endometriosis Knowledgebase

Search Result

Gene id

4909

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NTF4 Gene UCSC Ensembl

Aliases

GLC10, GLC1O, NT-4, NT-4/5, NT-5, NT4, NT5, NTF5

Gene name

neurotrophin 4

Alternate names

neurotrophin-4, neurotrophic factor 4, neurotrophic factor 5, neurotrophin 5 (neurotrophin 4/5), neurotrophin-5, neutrophic factor 4,

Gene location

19q13.33 (49065075: 49058283) Exons: 7 NC_000019.10

Gene summary(Entrez)

This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood. [provided by RefSeq, Jul 2008]

OMIM

162662

Protein Summary

Protein general information

P34130

Name: Neurotrophin 4 (NT 4) (Neurotrophin 5) (NT 5) (Neutrophic factor 4)

Length: 210 Mass: 22,427

Tissue specificity: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.

Sequence

MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPA
NRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGG
PGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Structural information

Interpro:	IPR029034 IPR020408 IPR002072 IPR019846 IPR020432
Prosite:	PS00248 PS50270
Pfam:	PF00243
PDB:	1B8M 1B98 1HCF
PDBsum:	1B8M 1B98 1HCF
MINT:	1508589
STRING:	ENSP00000301411;

Other Databases

GeneCards: NTF4; Malacards: NTF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005166	neurotrophin p75 receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	ISS	cellular_component
GO:0005788	endoplasmic reticulum lum en	ISS	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IBA	biological_process
GO:0007402	ganglion mother cell fate determination	ISS	biological_process
GO:0007616	long-term memory	ISS	biological_process
GO:0008052	sensory organ boundary sp ecification	ISS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008344	adult locomotory behavior	ISS	biological_process
GO:0008544	epidermis development	ISS	biological_process
GO:0042490	mechanoreceptor different iation	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IBA	biological_process
GO:0045664	regulation of neuron diff erentiation	IBA	biological_process
GO:0048812	neuron projection morphog enesis	IBA	biological_process
GO:0060384	innervation	IEA	biological_process
GO:0061193	taste bud development	IEA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005166	neurotrophin p75 receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	ISS	cellular_component
GO:0005788	endoplasmic reticulum lum en	ISS	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IBA	biological_process
GO:0007402	ganglion mother cell fate determination	IEA	biological_process
GO:0007402	ganglion mother cell fate determination	ISS	biological_process
GO:0007616	long-term memory	IEA	biological_process
GO:0007616	long-term memory	ISS	biological_process
GO:0008052	sensory organ boundary sp ecification	IEA	biological_process
GO:0008052	sensory organ boundary sp ecification	ISS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0008344	adult locomotory behavior	ISS	biological_process
GO:0008544	epidermis development	IEA	biological_process
GO:0008544	epidermis development	ISS	biological_process
GO:0042490	mechanoreceptor different iation	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IBA	biological_process
GO:0045664	regulation of neuron diff erentiation	IBA	biological_process
GO:0048812	neuron projection morphog enesis	IBA	biological_process
GO:0060384	innervation	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0061193	taste bud development	IEA	biological_process
GO:0005166	neurotrophin p75 receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	ISS	cellular_component
GO:0005788	endoplasmic reticulum lum en	ISS	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	IBA	biological_process
GO:0007402	ganglion mother cell fate determination	ISS	biological_process
GO:0007616	long-term memory	ISS	biological_process
GO:0008052	sensory organ boundary sp ecification	ISS	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008344	adult locomotory behavior	ISS	biological_process
GO:0008544	epidermis development	ISS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IBA	biological_process
GO:0045664	regulation of neuron diff erentiation	IBA	biological_process
GO:0048812	neuron projection morphog enesis	IBA	biological_process

KEGG pathways

hsa04010 MAPK signaling pathway
hsa04722 Neurotrophin signaling pathway

Diseases

Associated diseases	References
Attention-deficit hyperactivity disorder (ADHD)	PMID: 18179783
Autism	PMID: 19598235
Endometriosis	PMID: 22717347
Endometriosis	INFBASE22717347
Primary open angle glaucoma	KEGG: H00612
Several psychiatric disorders	PMID: 19086053

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22717347	Endometrio sis			33 women underg oing laparoscop y for infertili ty, pelvic pain , intramural fi broids, or tuba l ligation	Female infertility		Show abstract