Endometriosis Knowledgebase

Search Result

Gene id

5016

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

OVGP1 Gene UCSC Ensembl

Aliases

CHIT5, EGP, MUC9, OGP

Gene name

oviductal glycoprotein 1

Alternate names

oviduct-specific glycoprotein, estrogen-dependent oviduct protein, mucin 9, oviduct glycoprotein, oviductal glycoprotein 1, 120kDa, oviductin,

Gene location

1p13.2 (111427776: 111414314) Exons: 11 NC_000001.11

Gene summary(Entrez)

This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. [provided by RefSeq, Jul 2008]

OMIM

603578

Protein Summary

Protein general information

Q12889

Name: Oviduct-specific glycoprotein (Estrogen-dependent oviduct protein) (Mucin-9) (Oviductal glycoprotein) (Oviductin)

Length: 678 Mass: 75,421

Tissue specificity: Oviduct.

Sequence

MWKLLLWVGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKDLQDEK
ILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFFLYPGLRGSPM
HDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINVLSYDLHGSWERFTGH
NSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQARAIGPASPGKYTKQEGFLAYF
EICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLV
YVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTDSKILPPGGEAGVTEIHGKCENMTITPRGTT
VTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLT
PVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSE
VGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVD
EEA

Structural information

Interpro:	IPR011583 IPR029070 IPR001223 IPR017853
Pfam:	PF00704
STRING:	ENSP00000358747;

Other Databases

GeneCards: OVGP1; Malacards: OVGP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004568	chitinase activity	IBA	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0006032	chitin catabolic process	IBA	biological_process
GO:0007339	binding of sperm to zona pellucida	TAS	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0008061	chitin binding	IBA	molecular_function
GO:0030133	transport vesicle	IEA	cellular_component
GO:0035805	egg coat	IEA	cellular_component
GO:0098595	perivitelline space	IEA	cellular_component
GO:2000360	negative regulation of bi nding of sperm to zona pe llucida	IEA	biological_process
GO:0004553	hydrolase activity, hydro lyzing O-glycosyl compoun ds	IEA	molecular_function
GO:0004568	chitinase activity	IEA	molecular_function
GO:0004568	chitinase activity	IBA	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0006032	chitin catabolic process	IEA	biological_process
GO:0006032	chitin catabolic process	IBA	biological_process
GO:0007338	single fertilization	IEA	biological_process
GO:0007339	binding of sperm to zona pellucida	TAS	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0008061	chitin binding	IBA	molecular_function
GO:0030133	transport vesicle	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0035805	egg coat	IEA	cellular_component
GO:0098595	perivitelline space	IEA	cellular_component
GO:2000360	negative regulation of bi nding of sperm to zona pe llucida	IEA	biological_process
GO:0004568	chitinase activity	IBA	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006032	chitin catabolic process	IBA	biological_process
GO:0007339	binding of sperm to zona pellucida	TAS	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0008061	chitin binding	IBA	molecular_function

Diseases

Associated diseases	References
Endometriosis	PubMed12579308

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12579308	Endometrio sis			23 endometriosi s patients			Show abstract