Endometriosis Knowledgebase

Search Result

Gene id

5024

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

P2RX3 Gene UCSC Ensembl

Aliases

P2X3

Gene name

purinergic receptor P2X 3

Alternate names

P2X purinoceptor 3, ATP receptor, P2X receptor, subunit 3, purinergic receptor P2X, ligand gated ion channel, 3, purinergic receptor P2X3, purinoceptor P2X3,

Gene location

11q12.1 (169620520: 169723186) Exons: 16 NC_000004.12

Gene summary(Entrez)

This gene encodes a member of the P2X purinergic receptor (purinoceptor) gene family which includes seven members (P2RX1 - P2RX7). P2X purinoceptors are a family of cation-permeable, ligand-gated ion channels that open in response to the binding of extracellular adenosine 5'-triphosphate (ATP). The encoded protein is a subunit of the trimeric P2X3 receptor ion channel which is expressed by sensory or autonomic neurons. A deficiency of the orthologous protein in mice is associated with reduced pain-related behavior and urinary bladder hyporeflexia. [provided by RefSeq, Aug 2017]

OMIM

600843

Protein Summary

Protein general information

P56373

Name: P2X purinoceptor 3 (P2X3) (ATP receptor) (Purinergic receptor)

Length: 397 Mass: 44,289

Sequence

MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGSGLYANRVM
DVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVLRTCEIQ
GWCPTEVDTVETPIMMEAENFTIFIKNSIRFPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFA
GQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEEVNETTLKIAALTNPV
YPSDQTTAEKQSTDSGAFSIGH

Structural information

Interpro:	IPR003046 IPR027309 IPR001429
Prosite:	PS01212
Pfam:	PF00864
PDB:	5SVJ 5SVK 5SVL 5SVM 5SVP 5SVQ 5SVR 5SVS 5SVT
PDBsum:	5SVJ 5SVK 5SVL 5SVM 5SVP 5SVQ 5SVR 5SVS 5SVT
STRING:	ENSP00000263314;

Other Databases

GeneCards: P2RX3; Malacards: P2RX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001614	purinergic nucleotide rec eptor activity	IBA	molecular_function
GO:0001614	purinergic nucleotide rec eptor activity	NAS	molecular_function
GO:0001666	response to hypoxia	IEA	biological_process
GO:0004931	extracellular ATP-gated c ation channel activity	NAS	molecular_function
GO:0005524	ATP binding	NAS	molecular_function
GO:0005639	integral component of nuc lear inner membrane	IBA	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0006810	transport	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007274	neuromuscular synaptic tr ansmission	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009743	response to carbohydrate	IEA	biological_process
GO:0010524	positive regulation of ca lcium ion transport into cytosol	NAS	biological_process
GO:0014832	urinary bladder smooth mu scle contraction	IEA	biological_process
GO:0019228	neuronal action potential	IEA	biological_process
GO:0030432	peristalsis	IEA	biological_process
GO:0033198	response to ATP	IEA	biological_process
GO:0035590	purinergic nucleotide rec eptor signaling pathway	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043195	terminal bouton	IEA	cellular_component
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0048167	regulation of synaptic pl asticity	IEA	biological_process
GO:0050850	positive regulation of ca lcium-mediated signaling	NAS	biological_process
GO:0050909	sensory perception of tas te	IEA	biological_process
GO:0051260	protein homooligomerizati on	IEA	biological_process
GO:0061368	behavioral response to fo rmalin induced pain	IEA	biological_process
GO:0098655	cation transmembrane tran sport	IEA	biological_process
GO:1904058	positive regulation of se nsory perception of pain	IEA	biological_process
GO:0001614	purinergic nucleotide rec eptor activity	IEA	molecular_function
GO:0001614	purinergic nucleotide rec eptor activity	IBA	molecular_function
GO:0001614	purinergic nucleotide rec eptor activity	NAS	molecular_function
GO:0001666	response to hypoxia	IEA	biological_process
GO:0004931	extracellular ATP-gated c ation channel activity	IEA	molecular_function
GO:0004931	extracellular ATP-gated c ation channel activity	IEA	molecular_function
GO:0004931	extracellular ATP-gated c ation channel activity	NAS	molecular_function
GO:0004931	extracellular ATP-gated c ation channel activity	TAS	molecular_function
GO:0005216	ion channel activity	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	NAS	molecular_function
GO:0005639	integral component of nuc lear inner membrane	IBA	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	TAS	biological_process
GO:0006811	ion transport	IEA	biological_process
GO:0006811	ion transport	IEA	biological_process
GO:0006811	ion transport	IEA	biological_process
GO:0006812	cation transport	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IEA	biological_process
GO:0007274	neuromuscular synaptic tr ansmission	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009266	response to temperature s timulus	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009743	response to carbohydrate	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010524	positive regulation of ca lcium ion transport into cytosol	NAS	biological_process
GO:0014832	urinary bladder smooth mu scle contraction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019228	neuronal action potential	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030432	peristalsis	IEA	biological_process
GO:0033198	response to ATP	IEA	biological_process
GO:0033198	response to ATP	IEA	biological_process
GO:0035590	purinergic nucleotide rec eptor signaling pathway	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043195	terminal bouton	IEA	cellular_component
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0048167	regulation of synaptic pl asticity	IEA	biological_process
GO:0048266	behavioral response to pa in	IEA	biological_process
GO:0050850	positive regulation of ca lcium-mediated signaling	NAS	biological_process
GO:0050909	sensory perception of tas te	IEA	biological_process
GO:0051260	protein homooligomerizati on	IEA	biological_process
GO:0061368	behavioral response to fo rmalin induced pain	IEA	biological_process
GO:0098655	cation transmembrane tran sport	IEA	biological_process
GO:1904058	positive regulation of se nsory perception of pain	IEA	biological_process
GO:0001614	purinergic nucleotide rec eptor activity	IBA	molecular_function
GO:0001614	purinergic nucleotide rec eptor activity	NAS	molecular_function
GO:0004931	extracellular ATP-gated c ation channel activity	NAS	molecular_function
GO:0004931	extracellular ATP-gated c ation channel activity	TAS	molecular_function
GO:0005524	ATP binding	NAS	molecular_function
GO:0005639	integral component of nuc lear inner membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006810	transport	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0010524	positive regulation of ca lcium ion transport into cytosol	NAS	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0050850	positive regulation of ca lcium-mediated signaling	NAS	biological_process

KEGG pathways

hsa04742  Taste transduction
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Endometriosis	INFBASE28898282

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28898282	Endometrio sis						Show abstract