Endometriosis Knowledgebase

Search Result

Gene id

50486

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

G0S2 Gene UCSC Ensembl

Gene name

G0/G1 switch 2

Alternate names

G0/G1 switch protein 2, G0/G1 switch regulatory protein 2, G0/G1switch 2,

Gene location

1q32.2 (209675324: 209676389) Exons: 2 NC_000001.11

OMIM

614447

Protein Summary

Protein general information

P27469

Name: G0/G1 switch protein 2 (G0/G1 switch regulatory protein 2) (Putative lymphocyte G0/G1 switch gene)

Length: 103 Mass: 11,321

Tissue specificity: Widely expressed with highest levels in peripheral blood, skeletal muscle and heart, followed by kidney and liver. {ECO

Sequence

METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQAL
QKQALQEKGKQQDTVLGGRALSNRQHAS

Structural information

Interpro:	IPR016821
Pfam:	PF15103
STRING:	ENSP00000355996;

Other Databases

GeneCards: G0S2; Malacards: G0S2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005811	lipid particle	TAS	cellular_component
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:2001238	positive regulation of ex trinsic apoptotic signali ng pathway	IDA	biological_process
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005811	lipid particle	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:2001238	positive regulation of ex trinsic apoptotic signali ng pathway	IDA	biological_process
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005811	lipid particle	TAS	cellular_component
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:2001238	positive regulation of ex trinsic apoptotic signali ng pathway	IDA	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 12810542
Implantation failure	PMID: 12810542
Female infertility	INFBASE12810542
Implantation defects	INFBASE12810542
Endometriosis	INFBASE12810542

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12810542	Endometrio sis					IL-15 proline-rich protein B61 Dickkopf-1 glycodelin N-acetylglucosamine-6-O-sulfotransferase G0S2 protein purine nucleoside phosphorylase semaphorin E neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA Sam68-like phospho	Show abstract