Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 5055
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol SERPINB2   Gene   UCSC   Ensembl
Aliases HsT1201, PAI, PAI-2, PAI2, PLANH2
Gene name serpin family B member 2
Alternate names plasminogen activator inhibitor 2, monocyte Arg-serpin, placental plasminogen activator inhibitor, plasminogen activator inhibitor, type II (arginine-serpin), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 2, serpin B2, serpin peptidase ,
Gene location 18q21.33-q22.1 (63887704: 63903889)     Exons: 9     NC_000018.10
OMIM 173390

Protein Summary

Protein general information P05120  

Name: Plasminogen activator inhibitor 2 (PAI 2) (Monocyte Arg serpin) (Placental plasminogen activator inhibitor) (Serpin B2) (Urokinase inhibitor)

Length: 415  Mass: 46,596

Sequence MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPEN
FTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYS
SEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVN
SAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM
AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGG
VMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP
Structural information
Interpro:  IPR015556 IPR023795 IPR023796 IPR000215
Prosite:   PS00284

Pfam:  
PF00079

PDB:  
1BY7 1JRR 2ARQ 2ARR
PDBsum:   1BY7 1JRR 2ARQ 2ARR
MINT:   270968
STRING:   ENSP00000299502;
Other Databases GeneCards:  SERPINB2;  Malacards:  SERPINB2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0004867 serine-type endopeptidase
inhibitor activity
IBA molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
TAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0042060 wound healing
IEA biological_process
GO:0042730 fibrinolysis
TAS biological_process
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0004867 serine-type endopeptidase
inhibitor activity
IEA molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
IBA molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
IEA molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
TAS molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0010466 negative regulation of pe
ptidase activity
IEA biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0030414 peptidase inhibitor activ
ity
IEA molecular_function
GO:0042060 wound healing
IEA biological_process
GO:0042730 fibrinolysis
TAS biological_process
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0004867 serine-type endopeptidase
inhibitor activity
IBA molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
TAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0042730 fibrinolysis
TAS biological_process
GO:0043066 negative regulation of ap
optotic process
TAS biological_process

KEGG pathways

hsa04610  Complement and coagulation cascades

Diseases

Associated diseases References
Cancer PMID: 19117638
Cerebral palsy PMID: 19238444
Cerebral palsy PMID: 18977990
Diabetic nephropathy PMID: 19690890
Endometriosis PMID: 9806560
Endometriosis INFBASE9806560
Preterm delivery PMID: 17267840

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
9806560 Endometrio
sis


u-PA
PAI-1
PAI-2
Show abstract