Endometriosis Knowledgebase

Search Result

Gene id

5058

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PAK1 Gene UCSC Ensembl

Aliases

PAKalpha

Gene name

p21 (RAC1) activated kinase 1

Alternate names

serine/threonine-protein kinase PAK 1, STE20 homolog, yeast, alpha-PAK, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p65-PAK,

Gene location

11q13.5-q14.1 (77474062: 77322014) Exons: 19 NC_000011.10

Gene summary(Entrez)

This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

OMIM

602590

Protein Summary

Protein general information

Q13153

Name: Serine/threonine protein kinase PAK 1 (EC 2.7.11.1) (Alpha PAK) (p21 activated kinase 1) (PAK 1) (p65 PAK)

Length: 545 Mass: 60,647

Tissue specificity: Overexpressed in gastric cancer cells and tissues (at protein level) (PubMed

Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEI
SLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSA
EDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPT
ENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQ
ALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL
GIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAK
PLSSLTPLIAAAKEATKNNH

Structural information

Protein Domains	CRIB. (75-88) Protein (270-521)
Interpro:	IPR000095 IPR011009 IPR033923 IPR000719 IPR017441 IPR008271
Prosite:	PS50108 PS00107 PS50011 PS00108
Pfam:	PF00786 PF00069
CDD:	cd01093
PDB:	1F3M 1YHV 1YHW 1ZSG 2HY8 2QME 3DVP 3FXZ 3FY0 3Q4Z 3Q52 3Q53 4DAW 4EQC 4O0R 4O0T 4P90 4ZJI 4ZJJ 4ZLO 4ZY4 4ZY5 4ZY6 5DEW 5DEY 5DFP 5IME 5KBQ 5KBR
PDBsum:	1F3M 1YHV 1YHW 1ZSG 2HY8 2QME 3DVP 3FXZ 3FY0 3Q4Z 3Q52 3Q53 4DAW 4EQC 4O0R 4O0T 4P90 4ZJI 4ZJJ 4ZLO 4ZY4 4ZY5 4ZY6 5DEW 5DEY 5DFP 5IME 5KBQ 5KBR
DIP:	31016
MINT:	92897
STRING:	ENSP00000278568;

Other Databases

GeneCards: PAK1; Malacards: PAK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001726	ruffle	IDA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004702	signal transducer, downst ream of receptor, with se rine/threonine kinase act ivity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006887	exocytosis	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007409	axonogenesis	IBA	biological_process
GO:0014704	intercalated disc	ISS	cellular_component
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0030018	Z disc	ISS	cellular_component
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031532	actin cytoskeleton reorga nization	IMP	biological_process
GO:0031532	actin cytoskeleton reorga nization	IDA	biological_process
GO:0031965	nuclear membrane	ISS	cellular_component
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033148	positive regulation of in tracellular estrogen rece ptor signaling pathway	IDA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042060	wound healing	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043507	positive regulation of JU N kinase activity	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IMP	biological_process
GO:0048812	neuron projection morphog enesis	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IMP	biological_process
GO:0060244	negative regulation of ce ll proliferation involved in contact inhibition	IMP	biological_process
GO:0071437	invadopodium	IDA	cellular_component
GO:0000165	MAPK cascade	IDA	biological_process
GO:0000278	mitotic cell cycle	IBA	biological_process
GO:0031941	filamentous actin	NAS	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001726	ruffle	IDA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0003824	catalytic activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004702	signal transducer, downst ream of receptor, with se rine/threonine kinase act ivity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006887	exocytosis	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007409	axonogenesis	IBA	biological_process
GO:0008152	metabolic process	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0014704	intercalated disc	IEA	cellular_component
GO:0014704	intercalated disc	ISS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0023014	signal transduction by pr otein phosphorylation	IEA	biological_process
GO:0030018	Z disc	IEA	cellular_component
GO:0030018	Z disc	ISS	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031532	actin cytoskeleton reorga nization	IMP	biological_process
GO:0031532	actin cytoskeleton reorga nization	IDA	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0031965	nuclear membrane	ISS	cellular_component
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032956	regulation of actin cytos keleton organization	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033148	positive regulation of in tracellular estrogen rece ptor signaling pathway	IDA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042060	wound healing	IMP	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043234	protein complex	IDA	cellular_component
GO:0043507	positive regulation of JU N kinase activity	IMP	biological_process
GO:0046777	protein autophosphorylati on	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IMP	biological_process
GO:0048812	neuron projection morphog enesis	IEA	biological_process
GO:0048812	neuron projection morphog enesis	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IMP	biological_process
GO:0060244	negative regulation of ce ll proliferation involved in contact inhibition	IMP	biological_process
GO:0071437	invadopodium	IEA	cellular_component
GO:0071437	invadopodium	IDA	cellular_component
GO:0000165	MAPK cascade	IDA	biological_process
GO:0000278	mitotic cell cycle	IBA	biological_process
GO:0031941	filamentous actin	NAS	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0001726	ruffle	IDA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004702	signal transducer, downst ream of receptor, with se rine/threonine kinase act ivity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0007409	axonogenesis	IBA	biological_process
GO:0014704	intercalated disc	ISS	cellular_component
GO:0030018	Z disc	ISS	cellular_component
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031532	actin cytoskeleton reorga nization	IMP	biological_process
GO:0031532	actin cytoskeleton reorga nization	IDA	biological_process
GO:0031965	nuclear membrane	ISS	cellular_component
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033148	positive regulation of in tracellular estrogen rece ptor signaling pathway	IDA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042060	wound healing	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043507	positive regulation of JU N kinase activity	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IMP	biological_process
GO:0048812	neuron projection morphog enesis	ISS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IMP	biological_process
GO:0060244	negative regulation of ce ll proliferation involved in contact inhibition	IMP	biological_process
GO:0071437	invadopodium	IDA	cellular_component
GO:0000165	MAPK cascade	IDA	biological_process
GO:0000278	mitotic cell cycle	IBA	biological_process
GO:0031941	filamentous actin	NAS	cellular_component
GO:0005515	protein binding	IPI	molecular_function

KEGG pathways

hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04062  Chemokine signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04650  Natural killer cell mediated cytotoxicity
hsa04024  cAMP signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa04012  ErbB signaling pathway
hsa05211  Renal cell carcinoma
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04666  Fc gamma R-mediated phagocytosis
hsa04392  Hippo signaling pathway -multiple species
PTHR24361:SF232  CCKR signaling map
PTHR24361:SF232  CCKR signaling map

Diseases

Associated diseases	References
Cancer	PMID: 14607331
Endometriosis	PMID: 19168872
Jaw abnormalities	PMID: 22419666
Adenomyosis	INFBASE20079895
Endometriosis	INFBASE19168872
Adenomyosis	PMID: 5058
Parkinson's disease	PMID: 17052657

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19168872	Endometrio sis					Pak1	Show abstract
20079895	Endometrio sis					Pak1	Show abstract