Endometriosis Knowledgebase

Search Result

Gene id

506

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ATP5F1B Gene UCSC Ensembl

Aliases

ATP5B, ATPMB, ATPSB, HEL-S-271

Gene name

ATP synthase F1 subunit beta

Alternate names

ATP synthase subunit beta, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, epididymis secretory protein Li 271, mitochondrial ATP synthase beta subunit, mitochondrial ATP synthetase, beta subunit,

Gene location

12q13.3 (56646067: 56638174) Exons: 10 NC_000012.12

Gene summary(Entrez)

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. [provided by RefSeq, Jul 2008]

OMIM

102910

Protein Summary

Protein general information

P06576

Name: ATP synthase subunit beta, mitochondrial (EC 3.6.3.14) (ATP synthase F1 subunit beta)

Length: 529 Mass: 56,560

Sequence

MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAVVDVQF
DEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGE
PIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAK
AHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATT
FAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEED
KLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAE
EHSS

Structural information

Interpro:	IPR003593 IPR005722 IPR020003 IPR004100 IPR036121 IPR000194 IPR024034 IPR027417
Prosite:	PS00152
Pfam:	PF00006 PF02874
MINT:
STRING:	ENSP00000262030;

Other Databases

GeneCards: ATP5B; Malacards: ATP5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0005215	transporter activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005753	mitochondrial proton-tran sporting ATP synthase com plex	IDA	cellular_component
GO:0005754	mitochondrial proton-tran sporting ATP synthase, ca talytic core	NAS	cellular_component
GO:0005759	mitochondrial matrix	NAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006091	generation of precursor m etabolites and energy	NAS	biological_process
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006754	ATP biosynthetic process	IMP	biological_process
GO:0006754	ATP biosynthetic process	TAS	biological_process
GO:0006754	ATP biosynthetic process	TAS	biological_process
GO:0006933	negative regulation of ce ll adhesion involved in s ubstrate-bound cell migra tion	IEA	biological_process
GO:0007005	mitochondrion organizatio n	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0015991	ATP hydrolysis coupled pr oton transport	IEA	biological_process
GO:0015992	proton transport	IMP	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0022857	transmembrane transporter activity	IC	molecular_function
GO:0031966	mitochondrial membrane	IDA	cellular_component
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042645	mitochondrial nucleoid	IDA	cellular_component
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IC	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	TAS	biological_process
GO:0043209	myelin sheath	IEA	cellular_component
GO:0046933	proton-transporting ATP s ynthase activity, rotatio nal mechanism	IEA	molecular_function
GO:0046961	proton-transporting ATPas e activity, rotational me chanism	IMP	molecular_function
GO:0051453	regulation of intracellul ar pH	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0016887	ATPase activity	IDA	molecular_function
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001525	angiogenesis	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0005215	transporter activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005753	mitochondrial proton-tran sporting ATP synthase com plex	IDA	cellular_component
GO:0005754	mitochondrial proton-tran sporting ATP synthase, ca talytic core	NAS	cellular_component
GO:0005759	mitochondrial matrix	NAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006091	generation of precursor m etabolites and energy	NAS	biological_process
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006754	ATP biosynthetic process	IEA	biological_process
GO:0006754	ATP biosynthetic process	IMP	biological_process
GO:0006754	ATP biosynthetic process	TAS	biological_process
GO:0006754	ATP biosynthetic process	TAS	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006811	ion transport	IEA	biological_process
GO:0006933	negative regulation of ce ll adhesion involved in s ubstrate-bound cell migra tion	IEA	biological_process
GO:0007005	mitochondrion organizatio n	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0015986	ATP synthesis coupled pro ton transport	IEA	biological_process
GO:0015991	ATP hydrolysis coupled pr oton transport	IEA	biological_process
GO:0015992	proton transport	IEA	biological_process
GO:0015992	proton transport	IEA	biological_process
GO:0015992	proton transport	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016820	hydrolase activity, actin g on acid anhydrides, cat alyzing transmembrane mov ement of substances	IEA	molecular_function
GO:0022857	transmembrane transporter activity	IC	molecular_function
GO:0031966	mitochondrial membrane	IDA	cellular_component
GO:0033178	proton-transporting two-s ector ATPase complex, cat alytic domain	IEA	cellular_component
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042645	mitochondrial nucleoid	IDA	cellular_component
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IC	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	TAS	biological_process
GO:0043209	myelin sheath	IEA	cellular_component
GO:0045261	proton-transporting ATP s ynthase complex, catalyti c core F(1)	IEA	cellular_component
GO:0046034	ATP metabolic process	IEA	biological_process
GO:0046933	proton-transporting ATP s ynthase activity, rotatio nal mechanism	IEA	molecular_function
GO:0046961	proton-transporting ATPas e activity, rotational me chanism	IMP	molecular_function
GO:0051453	regulation of intracellul ar pH	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0016887	ATPase activity	IDA	molecular_function
GO:0001525	angiogenesis	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0005215	transporter activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005753	mitochondrial proton-tran sporting ATP synthase com plex	IDA	cellular_component
GO:0005754	mitochondrial proton-tran sporting ATP synthase, ca talytic core	NAS	cellular_component
GO:0005759	mitochondrial matrix	NAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005759	mitochondrial matrix	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006091	generation of precursor m etabolites and energy	NAS	biological_process
GO:0006754	ATP biosynthetic process	IMP	biological_process
GO:0006754	ATP biosynthetic process	TAS	biological_process
GO:0006754	ATP biosynthetic process	TAS	biological_process
GO:0007005	mitochondrion organizatio n	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0015992	proton transport	IMP	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0022857	transmembrane transporter activity	IC	molecular_function
GO:0031966	mitochondrial membrane	IDA	cellular_component
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042645	mitochondrial nucleoid	IDA	cellular_component
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IC	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	TAS	biological_process
GO:0046961	proton-transporting ATPas e activity, rotational me chanism	IMP	molecular_function
GO:0051453	regulation of intracellul ar pH	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0016887	ATPase activity	IDA	molecular_function

KEGG pathways

hsa00190  Oxidative phosphorylation
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
hsa04714  Thermogenesis
hsa01100  Metabolic pathways

Diseases

Associated diseases	References
Endometriosis	INFBASE16750201

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16750201	Endometrio sis					Vimentin beta-actin ATP synthase beta	Show abstract