Endometriosis Knowledgebase

Search Result

Gene id

51094

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ADIPOR1 Gene UCSC Ensembl

Aliases

ACDCR1, CGI-45, CGI45, PAQR1, TESBP1A

Gene name

adiponectin receptor 1

Alternate names

adiponectin receptor protein 1, progestin and adipoQ receptor family member 1, progestin and adipoQ receptor family member I,

Gene location

1q32.1 (202958571: 202940824) Exons: 11 NC_000001.11

Gene summary(Entrez)

This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]

OMIM

607945

Protein Summary

Protein general information

Q96A54

Name: Adiponectin receptor protein 1 (Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)

Length: 375 Mass: 42,616

Tissue specificity: Widely expressed (PubMed

Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHH
AMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF
LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLY
YSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Structural information

Interpro:	IPR004254
Pfam:	PF03006
PDB:	3WXV 5LXG
PDBsum:	3WXV 5LXG
DIP:	48622
MINT:
STRING:	ENSP00000341785;

Other Databases

GeneCards: ADIPOR1; Malacards: ADIPOR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	IDA	biological_process
GO:0010906	regulation of glucose met abolic process	ISS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019216	regulation of lipid metab olic process	ISS	biological_process
GO:0019395	fatty acid oxidation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0033210	leptin-mediated signaling pathway	IEA	biological_process
GO:0033211	adiponectin-activated sig naling pathway	IDA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0055100	adiponectin binding	IDA	molecular_function
GO:0097003	adipokinetic hormone rece ptor activity	IDA	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	IDA	biological_process
GO:0010906	regulation of glucose met abolic process	IEA	biological_process
GO:0010906	regulation of glucose met abolic process	ISS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019216	regulation of lipid metab olic process	IEA	biological_process
GO:0019216	regulation of lipid metab olic process	ISS	biological_process
GO:0019395	fatty acid oxidation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0033210	leptin-mediated signaling pathway	IEA	biological_process
GO:0033211	adiponectin-activated sig naling pathway	IEA	biological_process
GO:0033211	adiponectin-activated sig naling pathway	IDA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0055100	adiponectin binding	IEA	molecular_function
GO:0055100	adiponectin binding	IDA	molecular_function
GO:0097003	adipokinetic hormone rece ptor activity	IDA	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0009755	hormone-mediated signalin g pathway	IDA	biological_process
GO:0010906	regulation of glucose met abolic process	ISS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0019216	regulation of lipid metab olic process	ISS	biological_process
GO:0019395	fatty acid oxidation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0033211	adiponectin-activated sig naling pathway	IDA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0055100	adiponectin binding	IDA	molecular_function
GO:0097003	adipokinetic hormone rece ptor activity	IDA	molecular_function

KEGG pathways

hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04152  AMPK signaling pathway

Diseases

Associated diseases	References
Metabolic syndrome	GAD20032495
Hypertension	GAD18097620
Hypertension	GAD19536175
Alzheimer's disease	GAD19141999
Diabetes	GAD20628086
Colorectal cancer	GAD18827209
Breast cancer	GAD19723917
Breast cancer	GAD18451143
Atherosclerosis	GAD17003341
Endometriosis	PubMed26459399

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26459399	Endometrio sis			7 endometrial b iopsies		AdipoR1 AdipoR2	Show abstract