Endometriosis Knowledgebase

Search Result

Gene id

5111

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PCNA Gene UCSC Ensembl

Aliases

ATLD2

Gene name

proliferating cell nuclear antigen

Alternate names

proliferating cell nuclear antigen, DNA polymerase delta auxiliary protein, cyclin,

Gene location

20p12.3 (5126621: 5114952) Exons: 7 NC_000020.11

Gene summary(Entrez)

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq, Jul 2008]

OMIM

176740

Protein Summary

Protein general information

P12004

Name: Proliferating cell nuclear antigen (PCNA) (Cyclin)

Length: 261 Mass: 28,769

Sequence

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSM
SKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRD
LSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTV
TLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Structural information

Interpro:	IPR000730 IPR022649 IPR022659 IPR022648
Prosite:	PS01251 PS00293
Pfam:	PF02747 PF00705
PDB:	1AXC 1U76 1U7B 1UL1 1VYJ 1VYM 1W60 2ZVK 2ZVL 2ZVM 3JA9 3P87 3TBL 3VKX 3WGW 4D2G 4RJF 4ZTD 5E0T 5E0U 5E0V 5IY4 5L7C 5MOM
PDBsum:	1AXC 1U76 1U7B 1UL1 1VYJ 1VYM 1W60 2ZVK 2ZVL 2ZVM 3JA9 3P87 3TBL 3VKX 3WGW 4D2G 4RJF 4ZTD 5E0T 5E0U 5E0V 5IY4 5L7C 5MOM
DIP:	1098
MINT:	5000943
STRING:	ENSP00000368438;

Other Databases

GeneCards: PCNA; Malacards: PCNA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000083	regulation of transcripti on involved in G1/S trans ition of mitotic cell cyc le	TAS	biological_process
GO:0000701	purine-specific mismatch base pair DNA N-glycosyla se activity	IDA	molecular_function
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000723	telomere maintenance	TAS	biological_process
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular_component
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003684	damaged DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005663	DNA replication factor C complex	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0006271	DNA strand elongation inv olved in DNA replication	TAS	biological_process
GO:0006272	leading strand elongation	IBA	biological_process
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological_process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological_process
GO:0006297	nucleotide-excision repai r, DNA gap filling	TAS	biological_process
GO:0006298	mismatch repair	IDA	biological_process
GO:0006298	mismatch repair	TAS	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019985	translesion synthesis	IDA	biological_process
GO:0019985	translesion synthesis	TAS	biological_process
GO:0030331	estrogen receptor binding	IEA	molecular_function
GO:0030337	DNA polymerase processivi ty factor activity	IBA	molecular_function
GO:0030855	epithelial cell different iation	IEP	biological_process
GO:0030894	replisome	TAS	cellular_component
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031297	replication fork processi ng	ISS	biological_process
GO:0032077	positive regulation of de oxyribonuclease activity	IDA	biological_process
GO:0032139	dinucleotide insertion or deletion binding	IDA	molecular_function
GO:0032405	MutLalpha complex binding	IDA	molecular_function
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological_process
GO:0033993	response to lipid	IEA	biological_process
GO:0034644	cellular response to UV	IDA	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042769	DNA damage response, dete ction of DNA damage	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043596	nuclear replication fork	IDA	cellular_component
GO:0043626	PCNA complex	IDA	cellular_component
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045740	positive regulation of DN A replication	IMP	biological_process
GO:0046686	response to cadmium ion	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070182	DNA polymerase binding	IPI	molecular_function
GO:0070182	DNA polymerase binding	IPI	molecular_function
GO:0070557	PCNA-p21 complex	IDA	cellular_component
GO:0070987	error-free translesion sy nthesis	TAS	biological_process
GO:1902990	mitotic telomere maintena nce via semi-conservative replication	ISS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000083	regulation of transcripti on involved in G1/S trans ition of mitotic cell cyc le	TAS	biological_process
GO:0000701	purine-specific mismatch base pair DNA N-glycosyla se activity	IDA	molecular_function
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000723	telomere maintenance	TAS	biological_process
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular_component
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003684	damaged DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005663	DNA replication factor C complex	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0006260	DNA replication	IEA	biological_process
GO:0006271	DNA strand elongation inv olved in DNA replication	TAS	biological_process
GO:0006272	leading strand elongation	IBA	biological_process
GO:0006275	regulation of DNA replica tion	IEA	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological_process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological_process
GO:0006297	nucleotide-excision repai r, DNA gap filling	TAS	biological_process
GO:0006298	mismatch repair	IDA	biological_process
GO:0006298	mismatch repair	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019985	translesion synthesis	IDA	biological_process
GO:0019985	translesion synthesis	TAS	biological_process
GO:0030331	estrogen receptor binding	IEA	molecular_function
GO:0030337	DNA polymerase processivi ty factor activity	IEA	molecular_function
GO:0030337	DNA polymerase processivi ty factor activity	IBA	molecular_function
GO:0030855	epithelial cell different iation	IEP	biological_process
GO:0030894	replisome	TAS	cellular_component
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031297	replication fork processi ng	ISS	biological_process
GO:0032077	positive regulation of de oxyribonuclease activity	IDA	biological_process
GO:0032139	dinucleotide insertion or deletion binding	IDA	molecular_function
GO:0032405	MutLalpha complex binding	IDA	molecular_function
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological_process
GO:0033993	response to lipid	IEA	biological_process
GO:0034644	cellular response to UV	IDA	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042769	DNA damage response, dete ction of DNA damage	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043596	nuclear replication fork	IDA	cellular_component
GO:0043626	PCNA complex	IDA	cellular_component
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045740	positive regulation of DN A replication	IMP	biological_process
GO:0046686	response to cadmium ion	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070182	DNA polymerase binding	IPI	molecular_function
GO:0070182	DNA polymerase binding	IPI	molecular_function
GO:0070557	PCNA-p21 complex	IDA	cellular_component
GO:0070987	error-free translesion sy nthesis	TAS	biological_process
GO:1902990	mitotic telomere maintena nce via semi-conservative replication	ISS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000083	regulation of transcripti on involved in G1/S trans ition of mitotic cell cyc le	TAS	biological_process
GO:0000701	purine-specific mismatch base pair DNA N-glycosyla se activity	IDA	molecular_function
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000722	telomere maintenance via recombination	TAS	biological_process
GO:0000723	telomere maintenance	TAS	biological_process
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular_component
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003684	damaged DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005663	DNA replication factor C complex	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0006271	DNA strand elongation inv olved in DNA replication	TAS	biological_process
GO:0006272	leading strand elongation	IBA	biological_process
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological_process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological_process
GO:0006297	nucleotide-excision repai r, DNA gap filling	TAS	biological_process
GO:0006298	mismatch repair	IDA	biological_process
GO:0006298	mismatch repair	TAS	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019985	translesion synthesis	IDA	biological_process
GO:0019985	translesion synthesis	TAS	biological_process
GO:0030337	DNA polymerase processivi ty factor activity	IBA	molecular_function
GO:0030855	epithelial cell different iation	IEP	biological_process
GO:0030894	replisome	TAS	cellular_component
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031297	replication fork processi ng	ISS	biological_process
GO:0032077	positive regulation of de oxyribonuclease activity	IDA	biological_process
GO:0032139	dinucleotide insertion or deletion binding	IDA	molecular_function
GO:0032405	MutLalpha complex binding	IDA	molecular_function
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological_process
GO:0034644	cellular response to UV	IDA	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042276	error-prone translesion s ynthesis	TAS	biological_process
GO:0042769	DNA damage response, dete ction of DNA damage	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043596	nuclear replication fork	IDA	cellular_component
GO:0043626	PCNA complex	IDA	cellular_component
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045740	positive regulation of DN A replication	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070182	DNA polymerase binding	IPI	molecular_function
GO:0070182	DNA polymerase binding	IPI	molecular_function
GO:0070557	PCNA-p21 complex	IDA	cellular_component
GO:0070987	error-free translesion sy nthesis	TAS	biological_process
GO:1902990	mitotic telomere maintena nce via semi-conservative replication	ISS	biological_process

KEGG pathways

hsa05166  HTLV-I infection
hsa05161  Hepatitis B
PTHR11352:SF0  DNA replication
hsa04110  Cell cycle
hsa04530  Tight junction
hsa03410  Base excision repair
hsa03430  Mismatch repair
hsa03420  Nucleotide excision repair
hsa03030  DNA replication

Diseases

Associated diseases	References
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometrial cancer	PMID: 22056701
Endometriosis	PMID: 22056701
Hypospermatogenesis	PMID: 11704108
Endometrial carcinoma	INFBASE22056701
Endometriosis	INFBASE22056701
Sertoli cell-only syndrome (SCOS)	PMID: 11250796

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22056701	Endometrio sis			97		MMP2 MMP9 PCNA	Show abstract
28438065	Endometrio sis					TGFB1 Snail CDH1 VIM PCNA	Show abstract