Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 51561
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol IL23A   Gene   UCSC   Ensembl
Aliases IL-23, IL-23A, IL23P19, P19, SGRF
Gene name interleukin 23 subunit alpha
Alternate names interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, IL-23p19, JKA3 induced upon T-cell activation, interleukin 23 p19 subunit, interleukin 23, alpha subunit p19, interleukin-23 subunit p19, interleukin-six, G-CSF related factor,
Gene location 12q13.3 (56334158: 56340409)     Exons: 6     NC_000012.12
Gene summary(Entrez) This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq, Jul 2008]
OMIM 605580

Protein Summary
Protein general information Q9NPF7  

Name: Interleukin 23 subunit alpha (IL 23 subunit alpha) (IL 23 A) (Interleukin 23 subunit p19) (IL 23p19)

Length: 189  Mass: 20,730

Tissue specificity: Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level). {ECO

Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGD
GCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSL
SPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Structural information
Interpro:  IPR009079 IPR010831

Pfam:  		 PF16649

PDB:  		 3D85 3D87 3DUH 3QWR 4GRW 5MJ3 5MJ4
PDBsum:   3D85 3D87 3DUH 3QWR 4GRW 5MJ3 5MJ4
STRING:   ENSP00000228534;
Other Databases GeneCards:  IL23A;  Malacards:  IL23A

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
 ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 IDA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 ISS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 IDA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 TAS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 NAS biological_process
GO:0005125 cytokine activity
 IEA molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0006954 inflammatory response
 IEA biological_process
GO:0010535 positive regulation of ac
tivation of JAK2 kinase a
ctivity
 IDA biological_process
GO:0032693 negative regulation of in
terleukin-10 production
 IMP biological_process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 TAS biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 TAS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
 IMP biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
 IC biological_process
GO:0032819 positive regulation of na
tural killer cell prolife
ration
 IDA biological_process
GO:0034105 positive regulation of ti
ssue remodeling
 IC biological_process
GO:0042098 T cell proliferation
 IEA biological_process
GO:0042102 positive regulation of T
cell proliferation
 IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
 IDA biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 TAS biological_process
GO:0042510 regulation of tyrosine ph
osphorylation of Stat1 pr
otein
 IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
 IDA biological_process
GO:0043382 positive regulation of me
mory T cell differentiati
on
 ISS biological_process
GO:0045087 innate immune response
 IEA biological_process
GO:0045672 positive regulation of os
teoclast differentiation
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological_process
GO:0048771 tissue remodeling
 IEA biological_process
GO:0050729 positive regulation of in
flammatory response
 IC biological_process
GO:0050829 defense response to Gram-
negative bacterium
 IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
 IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
 IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
 IC biological_process
GO:0051142 positive regulation of NK
T cell proliferation
 IDA biological_process
GO:0051607 defense response to virus
 IEA biological_process
GO:0070743 interleukin-23 complex
 IDA cellular_component
GO:0090023 positive regulation of ne
utrophil chemotaxis
 IEA biological_process
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
 ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 IBA biological_process
GO:0045519 interleukin-23 receptor b
inding
 IDA molecular_function
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
 IEA biological_process
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
 ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 IEA biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 IDA biological_process
GO:0002376 immune system process
 IEA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 IEA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 ISS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 IDA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 TAS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 NAS biological_process
GO:0005125 cytokine activity
 IEA molecular_function
GO:0005125 cytokine activity
 IEA molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005615 extracellular space
 IEA cellular_component
GO:0005615 extracellular space
 IEA cellular_component
GO:0006954 inflammatory response
 IEA biological_process
GO:0006955 immune response
 IEA biological_process
GO:0010535 positive regulation of ac
tivation of JAK2 kinase a
ctivity
 IDA biological_process
GO:0032693 negative regulation of in
terleukin-10 production
 IMP biological_process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 TAS biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 TAS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
 IMP biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
 IC biological_process
GO:0032819 positive regulation of na
tural killer cell prolife
ration
 IDA biological_process
GO:0034105 positive regulation of ti
ssue remodeling
 IC biological_process
GO:0042098 T cell proliferation
 IEA biological_process
GO:0042102 positive regulation of T
cell proliferation
 IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
 IDA biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 TAS biological_process
GO:0042510 regulation of tyrosine ph
osphorylation of Stat1 pr
otein
 IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
 IDA biological_process
GO:0043382 positive regulation of me
mory T cell differentiati
on
 IEA biological_process
GO:0043382 positive regulation of me
mory T cell differentiati
on
 ISS biological_process
GO:0045087 innate immune response
 IEA biological_process
GO:0045519 interleukin-23 receptor b
inding
 IEA molecular_function
GO:0045672 positive regulation of os
teoclast differentiation
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological_process
GO:0048771 tissue remodeling
 IEA biological_process
GO:0050729 positive regulation of in
flammatory response
 IC biological_process
GO:0050829 defense response to Gram-
negative bacterium
 IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
 IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
 IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
 IC biological_process
GO:0051142 positive regulation of NK
T cell proliferation
 IDA biological_process
GO:0051607 defense response to virus
 IEA biological_process
GO:0070743 interleukin-23 complex
 IEA cellular_component
GO:0070743 interleukin-23 complex
 IDA cellular_component
GO:0090023 positive regulation of ne
utrophil chemotaxis
 IEA biological_process
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
 IEA biological_process
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
 ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 IEA biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 IBA biological_process
GO:0045519 interleukin-23 receptor b
inding
 IDA molecular_function
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
 ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
 IDA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 ISS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 IDA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 TAS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
 NAS biological_process
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0010535 positive regulation of ac
tivation of JAK2 kinase a
ctivity
 IDA biological_process
GO:0032693 negative regulation of in
terleukin-10 production
 IMP biological_process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 TAS biological_process
GO:0032729 positive regulation of in
terferon-gamma production
 IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 TAS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
 IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
 IMP biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
 IC biological_process
GO:0032819 positive regulation of na
tural killer cell prolife
ration
 IDA biological_process
GO:0034105 positive regulation of ti
ssue remodeling
 IC biological_process
GO:0042102 positive regulation of T
cell proliferation
 IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
 IDA biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 TAS biological_process
GO:0042510 regulation of tyrosine ph
osphorylation of Stat1 pr
otein
 IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
 IDA biological_process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
 IDA biological_process
GO:0043382 positive regulation of me
mory T cell differentiati
on
 ISS biological_process
GO:0045672 positive regulation of os
teoclast differentiation
 IDA biological_process
GO:0050729 positive regulation of in
flammatory response
 IC biological_process
GO:0050829 defense response to Gram-
negative bacterium
 IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
 IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
 IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
 IC biological_process
GO:0051142 positive regulation of NK
T cell proliferation
 IDA biological_process
GO:0070743 interleukin-23 complex
 IDA cellular_component
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
 ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
 IBA biological_process
GO:0045519 interleukin-23 receptor b
inding
 IDA molecular_function

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05152  Tuberculosis
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa05133  Pertussis

Diseases

Associated diseases References
Endometriosis PMID: 22007253
Male Infertility PMID: 21244563
Ovarian hyperstimulation syndrome (OHSS) PMID: 26823856
Polycystic ovary syndrome (PCOS) INFBASE22007253
Female infertility INFBASE21392744
Endometriosis INFBASE21392744
Polycystic ovary syndrome (PCOS) PMID: 27146815
Psoriasis PMID: 17236132
Rheumatoid arthritis PMID: 17606463

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21392744 Endometrio
sis
80 ( 40 endomet
riosis, 40 cont
rols)
 Female infertility IL-10
IL-12
IL-17
and IL-23
 Show abstract
22007253 Endometrio
sis
155 women under
going in vitro
fertilization (
IVF)
 Female infertility IL-1
IL-6
IL-18
IFN-gamma
TNF-alpha
IL-12
IL-23
MIP-1?
MIP-1?
MCP-1
RANTES
IL-8
CD47
 Show abstract